Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans UPF0605 protein GA14893-like


LOCUS       XM_013249025            1168 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085027), mRNA.
ACCESSION   XM_013249025
VERSION     XM_013249025.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249025.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1168
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1168
                     /gene="LOC106085027"
                     /note="UPF0605 protein GA14893-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106085027"
     CDS             1..927
                     /gene="LOC106085027"
                     /codon_start=1
                     /product="UPF0605 protein GA14893-like"
                     /protein_id="XP_013104479.2"
                     /db_xref="GeneID:106085027"
                     /translation="MDLIITPEPHYIPGYTGHCPQLQFREGKTYAKLTNKILMDPCVN
                     HASELVLSKPGDPIPIQIPFESEVKALKNRSLLIDSTYQHPIIPGYDGFVPNLRNQVG
                     KRYIAAASTGLAQHEALAERMRCERRFLQHRDLLESGKGLFEAKLRERMMPMTQYNAP
                     LVPVRSRAQAIKMEECHEIKKEKLPYSKFTAPHFMENDDEEKYITNGYGGHIPMAMTH
                     FGKSSKQLTNSALADFTNNYHHRQSAEWCPMELTGIASSCPNLGQFVIYHRTIGMIPK
                     YSGHVPGEAFTIGCTYGNATVNAKRWLALHKD"
     polyA_site      1168
                     /gene="LOC106085027"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggatttga tcataactcc tgaaccgcac tatatacccg gctacactgg tcactgccct
       61 caactgcaat ttagagaggg caagacatat gccaaactaa cgaacaaaat tcttatggac
      121 ccatgtgtca accatgcctc cgagttagta ctatccaaac ctggagatcc gattcctatt
      181 caaattcctt ttgaaagtga agtaaaggca ttaaagaatc gttccttgct catcgattca
      241 acctatcaac atcccatcat accaggttat gatggatttg taccaaattt aaggaatcaa
      301 gttggcaagc gttacattgc agcagcatct acaggtctag ctcaacatga ggctttggct
      361 gagcgaatgc gttgtgaaag acgctttctg caacatagag atcttctcga gagtggtaag
      421 ggtttgtttg aggctaagtt acgtgagaga atgatgccta tgactcagta taatgcccct
      481 ttggtgccag ttaggtccag ggctcaggct ataaaaatgg aagaatgcca tgagattaag
      541 aaagaaaagt taccatattc caaatttact gcaccacatt ttatggaaaa tgatgatgag
      601 gaaaaatata taactaatgg ttacggtggt cacataccga tggcaatgac acattttggt
      661 aaaagcagca aacaactgac aaacagtgcg ctcgccgact ttacgaataa ttatcatcat
      721 cgccagagtg ccgaatggtg tcccatggag ttgacaggca ttgccagttc ctgtcccaat
      781 ttgggccagt ttgtcatcta tcatcgaaca attggtatga tacccaagta ttcaggacat
      841 gtgccggggg aggctttcac aattggctgt acctatggaa atgcaacagt taatgccaaa
      901 cgttggttgg cattgcacaa ggattgactt cggggattcg tttgttttgg tgggttggca
      961 tgacgaaggt gacttgtatc cattggcttt gtgacaaacg gtgtgaggag gttaaaattc
     1021 tatttgtgtg ttttaaattt tttgtactca ttctgttcgg atcacttgaa cctgtgtata
     1081 aatatttaaa gaattaagtg ttaaattgtg aatggctata caatgcccgg aataataaaa
     1141 gatttaacga aaatttttgt acaatgga