PREDICTED: Stomoxys calcitrans uncharacterized LOC106084984

LOCUS       XM_013248974             462 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084984), mRNA.
ACCESSION   XM_013248974
VERSION     XM_013248974.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248974.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..462
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..462
                     /gene="LOC106084984"
                     /note="uncharacterized LOC106084984; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106084984"
     CDS             1..462
                     /gene="LOC106084984"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084984"
                     /protein_id="XP_013104428.2"
                     /db_xref="GeneID:106084984"
                     /translation="MSNKAALLPLILEKVFEKYSASNIDNNLGDLFVELNAILTARVV
                     KAALNLLDHQCIVVYHNIPKTKQVAQVNESSSKIIWVFPHVNYCTCTYFQEQVLGAKD
                     PSTSSYTCEHVLALRLSHLLKSDKVRFEELPFSKLKVLLSNFLPEDNHQSD"
ORIGIN      
        1 atgtcaaata aagcggcatt gttgcctttg atcctggaaa aagttttcga aaagtactct
       61 gcctccaata ttgataataa tttaggtgat ttgtttgtgg aattaaatgc catattgacg
      121 gcacgtgtgg ttaaggcagc tttaaattta ctggaccacc aatgtattgt ggtctatcac
      181 aatatcccca aaactaaaca agtagcacaa gtaaacgaga gttcctcaaa aatcatttgg
      241 gtatttcctc atgttaatta ctgcacttgt acctacttcc aagagcaagt attgggtgcc
      301 aaagatccaa gtacatcctc ctacacctgc gaacacgttt tggctttacg tttgtctcat
      361 ctgcttaaaa gcgataaggt acgatttgag gaactgccgt ttagtaaatt aaaagtactg
      421 ctttccaact tcttaccaga ggataatcac cagagcgact ga