PREDICTED: Stomoxys calcitrans ficolin-2-like (LOC106084980), mRNA.

LOCUS       XM_013248973             889 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013248973
VERSION     XM_013248973.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..889
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..889
                     /gene="LOC106084980"
                     /note="ficolin-2-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:106084980"
     CDS             56..865
                     /gene="LOC106084980"
                     /codon_start=1
                     /product="ficolin-2-like"
                     /protein_id="XP_013104427.1"
                     /db_xref="GeneID:106084980"
                     /translation="MKHSLLLIVVSVVFVLGTNRTETKEFLDFNDPDDNNFIIKHLFV
                     KINTILERLDEEGTKTKRLQEDLRQSNMRLEALTKQQEKHFSNLQNREWKTILRRQDG
                     SVDFNRNWTEYKFGFGNRNGELFIGLEELHVLTTYGPPQELLVMLRSFENETRYAKYD
                     RFRVGNETEKYAIIELGTYSGDAGNSLEQHKGMKFSTPDQDNDIYDSLNCAKDWASGW
                     WFRKCYFCNLAGVYRSKSKSRGVDWTDWKRDNFSLMFAEMRLRSKISLINS"
     misc_feature    332..844
                     /gene="LOC106084980"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    569..571
                     /gene="LOC106084980"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(656..658,662..664,668..670)
                     /gene="LOC106084980"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(683..685,692..697,722..727)
                     /gene="LOC106084980"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     polyA_site      889
                     /gene="LOC106084980"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcacctttaa aatgttgtta ccagttgctt gccaacatca tttacattcg cagtaatgaa
       61 gcattcgctg ttgcttattg tggtttctgt agttttcgtt cttggcacca accgcacgga
      121 aacaaaggaa ttcttagact ttaatgatcc agatgacaac aatttcataa taaaacatct
      181 ctttgtgaaa atcaacacca tcctggaaag attagatgag gagggcacaa agacaaaacg
      241 gctgcaggaa gacttgagac aatccaatat gagacttgaa gcacttacca aacagcaaga
      301 aaaacacttt tcaaaccttc agaatagaga atggaaaact atacttcgac gccaagatgg
      361 ttcagtggat ttcaatagaa attggaccga atataaattt ggttttggta atcggaatgg
      421 ggaattattc attggtcttg aagaattgca tgtcttaacc acctatggcc caccccaaga
      481 gcttcttgtg atgttgcgaa gttttgaaaa tgaaacacga tatgccaaat acgatcgctt
      541 tcgggtgggc aatgagaccg agaaatatgc tataatcgaa ttgggcacat acagcggcga
      601 tgcaggtaat tcacttgaac aacataaggg tatgaaattt tcaactcctg atcaggataa
      661 tgatatctat gattcgttaa attgtgctaa agattgggcg agtggttggt ggtttcgcaa
      721 atgctatttt tgtaatttag ctggagtcta tagatccaaa tcgaaaagtc ggggcgttga
      781 ttggactgat tggaaaagag acaactttag cttaatgttt gccgaaatga gattaagatc
      841 aaaaatatca ttaataaatt catgattttc acaatgacca taagaaaaa