Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248971 1615 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013248971 VERSION XM_013248971.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248971.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1615 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1615 /gene="LOC106084982" /note="vitellogenin-2-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106084982" CDS 65..1414 /gene="LOC106084982" /codon_start=1 /product="vitellogenin-2-like" /protein_id="XP_013104425.2" /db_xref="GeneID:106084982" /translation="MNPLRTICLMMGVLALACAGSSGPRPMGMHYSRNSIKNSMKPTN WMSMSVLQSLPSLKDIKLRDLESMSTVEGAELMHRLYHLAQASQALEPSFAPKPSEIP AFLITPDNQKIDFKLSELPTIAKQYPHFGEQEVTAFITGLPSKFECVKDATRKIVQAY QQRYNRDSESSVHSYAAYDNEKRQRNNEEDKYSASASSYAKNYSNKPTGCLIVINFGD TISDFEQYVTLDSEKVGKDIGHILAKVLEENGDMQDNFHLIGSNAGANIAGAAGRQYT HETSHQLRRITGLDPVKTFAKNPEELTGLARGDAEFVDIIHTTANSMGTATRSGNVDF FPNGPNEAVEGADNIIDSSMLAVRYFAESVVPGNERNFPAVGAESIEEYKSQSGNGRH LYMGINTPFDAEGDYMLQVNTKSPYGRSTPAPKQKNQRHHNSFISHKSWKMTSQDYE" polyA_site 1615 /gene="LOC106084982" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggtaattgaa tttaatctct ctggttattt gtggtagtag agtgaagaag gtctgtttcg 61 aacgatgaat cccttgagaa cgatttgcct tatgatgggc gtccttgctt tggcttgcgc 121 cggtagcagt ggtccacgtc ccatgggcat gcactacagt cgcaactcca tcaagaacag 181 catgaagcca accaactgga tgtctatgtc ggttttgcaa tccttgcctt cattgaagga 241 tattaagctg agggatttgg agagcatgtc cactgttgaa ggtgccgagc tgatgcatcg 301 tttgtatcac ttggcccaag ccagccaagc tttggaaccc agctttgctc ccaagcccag 361 cgaaattcct gccttcctca tcacacccga caaccagaag atcgatttca aattgagcga 421 attgcccacc attgccaagc aatatcctca ctttggcgaa caagaggtga ccgccttcat 481 caccggtctc ccctccaaat tcgagtgcgt caaggatgcc acccgcaaaa ttgttcaagc 541 ctaccaacaa cgctataacc gtgactccga gagttccgtc cacagctatg ctgcctatga 601 caatgagaaa cgtcaacgca acaacgaaga agacaagtac tctgcctccg cctcttccta 661 tgccaagaac tactccaaca aacccaccgg ctgcttgatt gtcatcaact tcggtgatac 721 catctccgac tttgagcaat acgtcacttt ggattccgag aaagttggca aggatattgg 781 acacattttg gccaaggttt tggaggagaa cggtgatatg caagacaact tccatttgat 841 tggttcgaat gctggtgcca acattgccgg tgccgctggc cgtcaataca cccatgagac 901 tagccaccaa ttgcgtcgca tcaccggttt ggaccccgtc aagacttttg ccaagaaccc 961 cgaagaattg accggcttgg cccgtggtga tgccgaattc gttgacatca tccacaccac 1021 cgccaacagc atgggcactg ctacccgttc cggcaatgtt gacttcttcc ccaatggtcc 1081 caatgaggct gttgaaggtg ccgacaacat catcgattcc tccatgctcg ctgttcgcta 1141 ctttgccgag tccgttgtgc ccggcaatga acgtaacttc cccgctgttg gtgccgagtc 1201 catcgaagaa tacaagagcc aaagcggcaa tggcagacat ctctatatgg gcatcaacac 1261 ccccttcgat gctgagggcg actacatgtt gcaggtcaac accaagagtc cctatggtcg 1321 cagcacccct gcccccaagc aaaagaacca acgtcaccac aacagcttca tcagccacaa 1381 atcctggaaa atgacttccc aagattacga atagacgctg ctgatgattt ctatttagac 1441 cgagatcaat aatttgcttc gattcggttc gtttcgtatc gattcgaaaa gaacatctac 1501 taatttgttt tgtagctttg ttatttttaa tttatttaaa ttataatttt ttgtataatt 1561 tttttctcta tagcttttca atgcaataaa aataaaaaaa gatacaaaac caaaa