Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248927 971 bp mRNA linear INV 02-SEP-2023 protein 1-like (LOC106084942), mRNA. ACCESSION XM_013248927 VERSION XM_013248927.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248927.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..971 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..971 /gene="LOC106084942" /note="fibrinogen C domain-containing protein 1-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106084942" CDS 36..851 /gene="LOC106084942" /codon_start=1 /product="fibrinogen C domain-containing protein 1-like" /protein_id="XP_013104381.1" /db_xref="GeneID:106084942" /translation="MKHSLALFVITVGFVLGTNNTETKEFLDFNDPNDKNVIMGELFV KINTILIESRNRSDELTQRLSDQDRQIKKLKEDLKKAQLESYERLEKHIAMLQNKEWK TILRRQDGSVNFNRNWTEYKFGFGNRNGEFFIGLEELHVLTTYGPPQELLVVLQSFEN GTRYAKYDRFRVGNENEKYAILELGTYSGDAGDAMKHHKDVKFSTADEDNDSSDRSCA YIYRSGWWFKKCYHCNLAGFYRTTSAGDGVDWTVWKKDDFSLKFAEMRLRTQL" misc_feature 336..842 /gene="LOC106084942" /note="Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular...; Region: FReD; cd00087" /db_xref="CDD:238040" misc_feature 573..575 /gene="LOC106084942" /note="gamma-gamma dimer interface [polypeptide binding]; other site" /db_xref="CDD:238040" misc_feature order(660..662,666..668,672..674) /gene="LOC106084942" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238040" misc_feature order(684..686,693..698,723..728) /gene="LOC106084942" /note="polymerization pocket [active]" /db_xref="CDD:238040" polyA_site 971 /gene="LOC106084942" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ataacaacct tattctggca gttcatcccg aaactatgaa gcactccctt gccctttttg 61 taattacggt tggtttcgtg ctcggcacca acaatactga gaccaaggaa ttcttagatt 121 ttaatgatcc aaatgataaa aatgtcatta tgggagaact ttttgtaaaa atcaacacca 181 tcttgataga gagcagaaat agatccgatg agctgactca gagattatca gatcaagaca 241 gacagataaa aaaattgaag gaagacttga aaaaagccca gttggaatca tatgaaagac 301 tagaaaagca tattgcaatg cttcaaaata aagaatggaa aactatactc cgacgccaag 361 atggttcggt caatttcaac agaaattgga ccgaatacaa atttggattt ggcaatcgga 421 atggggaatt tttcattggt cttgaagaat tgcatgtctt aaccacctac ggcccacccc 481 aagagcttct tgtggtgttg caaagttttg aaaatggaac acgatatgcc aaatacgatc 541 gctttagggt gggcaacgag aacgagaaat atgccatact tgaattaggc acatacagcg 601 gtgatgcagg tgatgctatg aaacatcata aagacgttaa attttcaaca gctgatgagg 661 ataatgatag cagcgatagg agctgtgctt atatatatcg cagcggttgg tggtttaaaa 721 aatgctatca ttgtaatttg gccggatttt atagaacgac ttcggcaggt gatggagttg 781 attggacggt atggaaaaaa gatgattttt ccctaaagtt tgccgaaatg aggttaagaa 841 cacaacttta aaattcataa ttatttttga attcataaat aacacggaga gtgtgatacg 901 taaaaaataa ttataaaaga aaaactaagt ggattataaa ggaggataaa tataagtgcc 961 ataaaattga a