Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrinogen C domain-containing


LOCUS       XM_013248927             971 bp    mRNA    linear   INV 02-SEP-2023
            protein 1-like (LOC106084942), mRNA.
ACCESSION   XM_013248927
VERSION     XM_013248927.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248927.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..971
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..971
                     /gene="LOC106084942"
                     /note="fibrinogen C domain-containing protein 1-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon."
                     /db_xref="GeneID:106084942"
     CDS             36..851
                     /gene="LOC106084942"
                     /codon_start=1
                     /product="fibrinogen C domain-containing protein 1-like"
                     /protein_id="XP_013104381.1"
                     /db_xref="GeneID:106084942"
                     /translation="MKHSLALFVITVGFVLGTNNTETKEFLDFNDPNDKNVIMGELFV
                     KINTILIESRNRSDELTQRLSDQDRQIKKLKEDLKKAQLESYERLEKHIAMLQNKEWK
                     TILRRQDGSVNFNRNWTEYKFGFGNRNGEFFIGLEELHVLTTYGPPQELLVVLQSFEN
                     GTRYAKYDRFRVGNENEKYAILELGTYSGDAGDAMKHHKDVKFSTADEDNDSSDRSCA
                     YIYRSGWWFKKCYHCNLAGFYRTTSAGDGVDWTVWKKDDFSLKFAEMRLRTQL"
     misc_feature    336..842
                     /gene="LOC106084942"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    573..575
                     /gene="LOC106084942"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(660..662,666..668,672..674)
                     /gene="LOC106084942"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(684..686,693..698,723..728)
                     /gene="LOC106084942"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     polyA_site      971
                     /gene="LOC106084942"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ataacaacct tattctggca gttcatcccg aaactatgaa gcactccctt gccctttttg
       61 taattacggt tggtttcgtg ctcggcacca acaatactga gaccaaggaa ttcttagatt
      121 ttaatgatcc aaatgataaa aatgtcatta tgggagaact ttttgtaaaa atcaacacca
      181 tcttgataga gagcagaaat agatccgatg agctgactca gagattatca gatcaagaca
      241 gacagataaa aaaattgaag gaagacttga aaaaagccca gttggaatca tatgaaagac
      301 tagaaaagca tattgcaatg cttcaaaata aagaatggaa aactatactc cgacgccaag
      361 atggttcggt caatttcaac agaaattgga ccgaatacaa atttggattt ggcaatcgga
      421 atggggaatt tttcattggt cttgaagaat tgcatgtctt aaccacctac ggcccacccc
      481 aagagcttct tgtggtgttg caaagttttg aaaatggaac acgatatgcc aaatacgatc
      541 gctttagggt gggcaacgag aacgagaaat atgccatact tgaattaggc acatacagcg
      601 gtgatgcagg tgatgctatg aaacatcata aagacgttaa attttcaaca gctgatgagg
      661 ataatgatag cagcgatagg agctgtgctt atatatatcg cagcggttgg tggtttaaaa
      721 aatgctatca ttgtaatttg gccggatttt atagaacgac ttcggcaggt gatggagttg
      781 attggacggt atggaaaaaa gatgattttt ccctaaagtt tgccgaaatg aggttaagaa
      841 cacaacttta aaattcataa ttatttttga attcataaat aacacggaga gtgtgatacg
      901 taaaaaataa ttataaaaga aaaactaagt ggattataaa ggaggataaa tataagtgcc
      961 ataaaattga a