Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248891 461 bp mRNA linear INV 02-SEP-2023 (LOC106084919), mRNA. ACCESSION XM_013248891 VERSION XM_013248891.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248891.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..461 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..461 /gene="LOC106084919" /note="uncharacterized LOC106084919; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106084919" CDS 73..336 /gene="LOC106084919" /codon_start=1 /product="uncharacterized protein LOC106084919" /protein_id="XP_013104345.1" /db_xref="GeneID:106084919" /translation="MKFYTLIAVIFAIIGIAQAADKCTVNGKTFDQGEKYQPPGTCEI YECFGKNGMIHSNCPPIDTLKPCKYFPQDTSKPYPKCCARQKC" misc_feature 151..333 /gene="LOC106084919" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 461 /gene="LOC106084919" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccataatcag ttgatattta aacggcaaag agaatacaag tcatcaagac gaaaaagtcc 61 attcgagaca aaatgaaatt ctacacttta attgcagtaa tttttgccat tattggcatt 121 gctcaagctg ctgataaatg taccgtcaat ggtaagacat tcgatcaagg tgagaaatat 181 caacccccag gaacatgtga aatttatgaa tgttttggca aaaacggaat gatacactcc 241 aattgccctc caatagatac gctaaaaccc tgcaaatatt ttccacaaga tacttccaag 301 ccgtatccca aatgttgtgc ccgccagaaa tgctaaattt gacaaggggt ttataataat 361 aacgagtata tgtgtgtatt tcagtaaatt aaatatttaa cctgtatata aatacattac 421 ttttttcata aatcaatata ccgaaaaata ctttctatca a