Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084919


LOCUS       XM_013248891             461 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084919), mRNA.
ACCESSION   XM_013248891
VERSION     XM_013248891.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248891.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..461
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..461
                     /gene="LOC106084919"
                     /note="uncharacterized LOC106084919; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106084919"
     CDS             73..336
                     /gene="LOC106084919"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084919"
                     /protein_id="XP_013104345.1"
                     /db_xref="GeneID:106084919"
                     /translation="MKFYTLIAVIFAIIGIAQAADKCTVNGKTFDQGEKYQPPGTCEI
                     YECFGKNGMIHSNCPPIDTLKPCKYFPQDTSKPYPKCCARQKC"
     misc_feature    151..333
                     /gene="LOC106084919"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      461
                     /gene="LOC106084919"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccataatcag ttgatattta aacggcaaag agaatacaag tcatcaagac gaaaaagtcc
       61 attcgagaca aaatgaaatt ctacacttta attgcagtaa tttttgccat tattggcatt
      121 gctcaagctg ctgataaatg taccgtcaat ggtaagacat tcgatcaagg tgagaaatat
      181 caacccccag gaacatgtga aatttatgaa tgttttggca aaaacggaat gatacactcc
      241 aattgccctc caatagatac gctaaaaccc tgcaaatatt ttccacaaga tacttccaag
      301 ccgtatccca aatgttgtgc ccgccagaaa tgctaaattt gacaaggggt ttataataat
      361 aacgagtata tgtgtgtatt tcagtaaatt aaatatttaa cctgtatata aatacattac
      421 ttttttcata aatcaatata ccgaaaaata ctttctatca a