PREDICTED: Stomoxys calcitrans cytochrome c oxidase subunit 6B2

LOCUS       XM_013248774             593 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084843), transcript variant X1, mRNA.
ACCESSION   XM_013248774
VERSION     XM_013248774.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248774.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..593
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..593
                     /gene="LOC106084843"
                     /note="cytochrome c oxidase subunit 6B2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 14 Proteins"
                     /db_xref="GeneID:106084843"
     CDS             157..411
                     /gene="LOC106084843"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6B2 isoform X1"
                     /protein_id="XP_013104228.1"
                     /db_xref="GeneID:106084843"
                     /translation="MSKKGDTTMTAKLETAPFDPRFPNQNVTRYCYQSYVDFHRCQKK
                     RGANYEPCNYFKKVFTSMCPHAWVEKWNDQIDGGTFPGRI"
     misc_feature    181..405
                     /gene="LOC106084843"
                     /note="Cytochrome c oxidase subunit VIb. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_VIb; cd00926"
                     /db_xref="CDD:238466"
     misc_feature    order(193..204,229..240,325..327,334..354)
                     /gene="LOC106084843"
                     /note="Subunit VIb/II interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    229..231
                     /gene="LOC106084843"
                     /note="Subunit VIb/I interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(241..243,250..252,397..399)
                     /gene="LOC106084843"
                     /note="Subunit VIb/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(289..291,295..312)
                     /gene="LOC106084843"
                     /note="Subunit VIb/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(376..378,385..393)
                     /gene="LOC106084843"
                     /note="Subunit VIb/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     polyA_site      593
                     /gene="LOC106084843"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctattcgcta tttcaacgag gctacggcac agctacatta ggagacgtga cacagtcgca
       61 gcgataaatt aatttctttg aggaagcaag aaaaccacaa aagagcccgt cttatctttt
      121 tcaaacatat attaattcta ttcaatttcc tctcgcatgt cgaaaaaagg cgataccaca
      181 atgactgcca aattggaaac cgcccccttt gatccacgtt tccccaacca aaacgtgacc
      241 cgctactgct accagtccta tgtggatttc catcgttgcc agaagaagcg tggcgccaac
      301 tacgagccct gcaattactt caagaaggtc ttcacctcca tgtgccccca tgcctgggtt
      361 gagaagtgga acgatcaaat cgatggtggc accttccccg gcagaattta aattcattgt
      421 tctttagact aatatgaaaa gagttggctg ggtgatggag tttgccgctc tctcactcat
      481 ccgctggctt gctaacatac attacctttt aaaaaatata ttgtctgctg ttttgttgtc
      541 aacatcaatg aattgtgaat tctaccaaaa ataaaaacat tcaaacaaaa caa