Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248770 897 bp mRNA linear INV 02-SEP-2023 (LOC106084840), mRNA. ACCESSION XM_013248770 VERSION XM_013248770.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248770.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..897 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..897 /gene="LOC106084840" /note="FAD-linked sulfhydryl oxidase ALR; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106084840" CDS 108..623 /gene="LOC106084840" /codon_start=1 /product="FAD-linked sulfhydryl oxidase ALR" /protein_id="XP_013104224.2" /db_xref="GeneID:106084840" /translation="MTSYDSYGTPTKPDTNCRTCTDFKFWSKQQRQMFQKTTDNKDAA KSGAGDSNDNSLPREDCPLDKSKLGQSTWGLLHTMAAVYSDNPTDNQKSDIKTFFDVF SRLYPCEYCAKDFRKDLRENPVKVDSQHEFSQWLCQFHNRVNAKLGKAQFDCSKVNER WRDGWLDGSCD" polyA_site 897 /gene="LOC106084840" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tccaattaca gctaacagct gttccttctg tcggcaaatc agaaaaaaat aagcatttgt 61 acaaatttcc agaaattact aaataaaact aaacatccaa gtataaaatg actagctacg 121 attcctatgg tacaccaact aaaccggata ccaattgccg gacatgcact gatttcaaat 181 tttggtcaaa acaacagcgg caaatgtttc aaaaaacgac tgataacaaa gatgcagcaa 241 agagcggggc tggagatagc aacgataaca gcttacctag agaggattgt ccattggaca 301 aatctaagtt gggccaatcc acatggggtt tgctacacac catggccgct gtttactctg 361 acaatcccac agataatcaa aaaagtgata taaaaacttt ctttgatgtc ttctccaggc 421 tttatccttg cgagtattgt gcaaaggatt ttcgtaaaga cctacgagaa aatcccgtta 481 aggtggattc gcaacatgaa ttctcccaat ggctatgcca attccacaat cgtgtcaatg 541 caaaattggg aaaagcccaa tttgactgca gcaaggtaaa cgaaagatgg cgagacggtt 601 ggttagatgg ttcttgtgat taacttaact atgttgcata tgttattatt ttcaatttta 661 ttatgggtta tatttggatt ggatatgtaa ttgattagac gatgtagacc tgttaatgta 721 ttaagtagac ataactatta tcatatatta ttggatggaa acatgagctg ttgttttttc 781 tacactgctt tcagttaaaa tttttcgaaa agtttttaat tcctgtatgg aaaaaactat 841 acaaacacca ttttttgttt caaatgtaaa tatattgatg taatttttac actataa