Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248315 1109 bp mRNA linear INV 02-SEP-2023 (LOC106084561), mRNA. ACCESSION XM_013248315 VERSION XM_013248315.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248315.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1109 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1109 /gene="LOC106084561" /note="ras-related protein Rab-40C; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106084561" CDS 140..916 /gene="LOC106084561" /codon_start=1 /product="ras-related protein Rab-40C" /protein_id="XP_013103769.1" /db_xref="GeneID:106084561" /translation="MSISNMTKDYDYLLKVLLVGDSDVGKHEILSGLEDASSESPFCS GNAYKTTTILLEGKRVRLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGI DRWLKEVEEHAPGIPKVLVGNRLHLAFKRQVAAKQAELYASRNNMSCFEISPLCDFNI RESFCELARMALHRNGMERIWRNNKVLSLQELCCRTIVRRTSVYAIESLPLPPSVKST LKSYALTTSQCFNTLNNSSKSKNRCKTPISGSGRNSCCIT" misc_feature 161..676 /gene="LOC106084561" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 197..220 /gene="LOC106084561" /note="G1 box; other site" /db_xref="CDD:133321" misc_feature order(203..223,344..346,506..511,515..517,596..604) /gene="LOC106084561" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133321" misc_feature 266..268 /gene="LOC106084561" /note="G2 box; other site" /db_xref="CDD:133321" misc_feature 278..286 /gene="LOC106084561" /note="Switch I region; other site" /db_xref="CDD:133321" misc_feature 335..346 /gene="LOC106084561" /note="G3 box; other site" /db_xref="CDD:133321" misc_feature order(341..346,392..397) /gene="LOC106084561" /note="Switch II region; other site" /db_xref="CDD:133321" misc_feature 506..517 /gene="LOC106084561" /note="G4 box; other site" /db_xref="CDD:133321" misc_feature 596..604 /gene="LOC106084561" /note="G5 box; other site" /db_xref="CDD:133321" misc_feature 689..817 /gene="LOC106084561" /note="SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region of CIS/SOCS family proteins (in combination with a SH2 domain), ASBs (ankyrin repeat-containing proteins with a SOCS box), SSBs (SPRY domain-containing proteins...; Region: SOCS; cl02533" /db_xref="CDD:470605" misc_feature order(692..709,725..727,746..748,764..766) /gene="LOC106084561" /note="elongin B/C interaction [active]" /db_xref="CDD:239641" polyA_site 1109 /gene="LOC106084561" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aataattctt atttatacgt gttttttgtt attttatgaa gcttagtata aaactaaaag 61 ttaaaataat gcgaacaaat ttcttgaaaa taagtggtgc atacgcgaat ataaacaaac 121 gttaacttca attggtgtaa tgtctataag taacatgacg aaagactatg attacttgtt 181 aaaagtatta ttagtaggag atagcgatgt tggaaaacat gaaattctgt ccggcttgga 241 agacgcgtca tctgaaagtc ccttttgtag tggcaatgct tataagacga ccacaatact 301 gctggaaggc aaaagggtca gacttcaact atgggatact tctggtcaag gacggttctg 361 cacaattata agatcatatt cacggggagc ccaaggaatt atattggtct atgacattac 421 aaacaaatgg agtttcgatg gaattgatcg atggctcaaa gaagttgaag agcatgctcc 481 aggaatacca aaagttcttg ttggaaacag actccacttg gcctttaaaa gacaagtagc 541 agctaagcaa gcagagttgt acgcttcccg taataatatg tcatgttttg aaatatctcc 601 tctatgtgat tttaacatca gagaatcatt ctgcgaattg gcgcgtatgg ctcttcatag 661 aaatggtatg gaaagaattt ggcgaaacaa taaagttcta tcactacagg aattatgctg 721 ccgaaccata gtaagacgta ccagcgttta tgccattgaa tcattaccgt tacccccatc 781 tgtaaagtct acattgaaat catatgcatt aacaacatct caatgcttta ataccctaaa 841 taacagttcc aagagcaaaa accgatgtaa gactccaatt agtggtagcg gaagaaacag 901 ttgctgtata acgtgatcct gtggtacaca tattaagatt gaagcacaaa ataattgata 961 atcgtattcg caataacaaa aaaaaatgtc ctaatgtcca aatccgcctt agtacataac 1021 agtggtatcc gttggactgt ttaatccaac gtcaaaatac tatgtggcag gaaatgaaaa 1081 taaaaatgat ttattacggt gacgttttt