Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ras-related protein Rab-40C


LOCUS       XM_013248315            1109 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084561), mRNA.
ACCESSION   XM_013248315
VERSION     XM_013248315.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248315.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1109
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1109
                     /gene="LOC106084561"
                     /note="ras-related protein Rab-40C; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106084561"
     CDS             140..916
                     /gene="LOC106084561"
                     /codon_start=1
                     /product="ras-related protein Rab-40C"
                     /protein_id="XP_013103769.1"
                     /db_xref="GeneID:106084561"
                     /translation="MSISNMTKDYDYLLKVLLVGDSDVGKHEILSGLEDASSESPFCS
                     GNAYKTTTILLEGKRVRLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGI
                     DRWLKEVEEHAPGIPKVLVGNRLHLAFKRQVAAKQAELYASRNNMSCFEISPLCDFNI
                     RESFCELARMALHRNGMERIWRNNKVLSLQELCCRTIVRRTSVYAIESLPLPPSVKST
                     LKSYALTTSQCFNTLNNSSKSKNRCKTPISGSGRNSCCIT"
     misc_feature    161..676
                     /gene="LOC106084561"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    197..220
                     /gene="LOC106084561"
                     /note="G1 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    order(203..223,344..346,506..511,515..517,596..604)
                     /gene="LOC106084561"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133321"
     misc_feature    266..268
                     /gene="LOC106084561"
                     /note="G2 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    278..286
                     /gene="LOC106084561"
                     /note="Switch I region; other site"
                     /db_xref="CDD:133321"
     misc_feature    335..346
                     /gene="LOC106084561"
                     /note="G3 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    order(341..346,392..397)
                     /gene="LOC106084561"
                     /note="Switch II region; other site"
                     /db_xref="CDD:133321"
     misc_feature    506..517
                     /gene="LOC106084561"
                     /note="G4 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    596..604
                     /gene="LOC106084561"
                     /note="G5 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    689..817
                     /gene="LOC106084561"
                     /note="SOCS (suppressors of cytokine signaling) box. The
                     SOCS box is found in the C-terminal region of CIS/SOCS
                     family proteins (in combination with a SH2 domain), ASBs
                     (ankyrin repeat-containing proteins with a SOCS box), SSBs
                     (SPRY domain-containing proteins...; Region: SOCS;
                     cl02533"
                     /db_xref="CDD:470605"
     misc_feature    order(692..709,725..727,746..748,764..766)
                     /gene="LOC106084561"
                     /note="elongin B/C interaction [active]"
                     /db_xref="CDD:239641"
     polyA_site      1109
                     /gene="LOC106084561"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aataattctt atttatacgt gttttttgtt attttatgaa gcttagtata aaactaaaag
       61 ttaaaataat gcgaacaaat ttcttgaaaa taagtggtgc atacgcgaat ataaacaaac
      121 gttaacttca attggtgtaa tgtctataag taacatgacg aaagactatg attacttgtt
      181 aaaagtatta ttagtaggag atagcgatgt tggaaaacat gaaattctgt ccggcttgga
      241 agacgcgtca tctgaaagtc ccttttgtag tggcaatgct tataagacga ccacaatact
      301 gctggaaggc aaaagggtca gacttcaact atgggatact tctggtcaag gacggttctg
      361 cacaattata agatcatatt cacggggagc ccaaggaatt atattggtct atgacattac
      421 aaacaaatgg agtttcgatg gaattgatcg atggctcaaa gaagttgaag agcatgctcc
      481 aggaatacca aaagttcttg ttggaaacag actccacttg gcctttaaaa gacaagtagc
      541 agctaagcaa gcagagttgt acgcttcccg taataatatg tcatgttttg aaatatctcc
      601 tctatgtgat tttaacatca gagaatcatt ctgcgaattg gcgcgtatgg ctcttcatag
      661 aaatggtatg gaaagaattt ggcgaaacaa taaagttcta tcactacagg aattatgctg
      721 ccgaaccata gtaagacgta ccagcgttta tgccattgaa tcattaccgt tacccccatc
      781 tgtaaagtct acattgaaat catatgcatt aacaacatct caatgcttta ataccctaaa
      841 taacagttcc aagagcaaaa accgatgtaa gactccaatt agtggtagcg gaagaaacag
      901 ttgctgtata acgtgatcct gtggtacaca tattaagatt gaagcacaaa ataattgata
      961 atcgtattcg caataacaaa aaaaaatgtc ctaatgtcca aatccgcctt agtacataac
     1021 agtggtatcc gttggactgt ttaatccaac gtcaaaatac tatgtggcag gaaatgaaaa
     1081 taaaaatgat ttattacggt gacgttttt