Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein twisted gastrulation


LOCUS       XM_013248310             898 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084556), mRNA.
ACCESSION   XM_013248310
VERSION     XM_013248310.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248310.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..898
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..898
                     /gene="LOC106084556"
                     /note="protein twisted gastrulation; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084556"
     CDS             1..753
                     /gene="LOC106084556"
                     /codon_start=1
                     /product="protein twisted gastrulation"
                     /protein_id="XP_013103764.1"
                     /db_xref="GeneID:106084556"
                     /translation="MEILRSLTLGTLLLLAFIFFYSSVVESCNESVCAPIVSKCLLTQ
                     SCKCELKNCSCCHECLKCLGKKFYEECCSCVELCPKPNDTMNFFSKKSHVEDFEGVPE
                     LFNVLVSSPVDGLDWNIFTFQLDFDKVLSGPKMHSYPMENNDKNLDVAVKERDHMGTV
                     NCTVIYLDQCTSWNKCRQSCQSTGASGYRWFHDGCCECVGSTCINYGLNESRCRNCPE
                     PKDLGDDFDEDEDMQDFGDNMGPFDGSVNSNY"
     misc_feature    265..651
                     /gene="LOC106084556"
                     /note="Twisted gastrulation (Tsg) protein conserved
                     region; Region: Tsg; pfam04668"
                     /db_xref="CDD:461385"
     polyA_site      898
                     /gene="LOC106084556"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggagattt tgcggagttt aacgctaggc acattgttgc tacttgcatt tatatttttc
       61 tacagttcag tggtcgagtc atgtaacgaa tccgtatgtg ctcccatcgt ttccaaatgt
      121 ttgttgacac aaagttgtaa atgtgaatta aaaaattgtt cctgttgtca cgagtgtctc
      181 aaatgtcttg gaaagaaatt ctacgaagaa tgttgcagtt gtgtggagct ttgccccaag
      241 ccaaatgata ctatgaactt tttctctaaa aagtcccatg tggaagattt tgaaggtgta
      301 cccgagcttt ttaatgttct tgtttcctct ccagtggatg gcttggattg gaatatattt
      361 acattccaat tagattttga taaggtattg tctggtccaa aaatgcacag ttatcctatg
      421 gaaaacaatg ataagaactt ggatgttgcc gtcaaagaac gtgaccatat gggaacagtg
      481 aattgtactg ttatctatct cgatcaatgt acatcgtgga acaaatgtcg ccaaagctgt
      541 caaagcaccg gcgcaagtgg ttataggtgg ttccacgatg gttgctgtga gtgtgttggc
      601 tcaacatgca ttaattatgg actcaatgaa agtcgctgca gaaattgccc tgaacctaag
      661 gatttgggtg atgacttcga tgaggacgag gatatgcaag atttcggcga taacatggga
      721 ccgtttgacg gctctgtaaa tagcaactac taacccatgc agcagactct actcgatttt
      781 tttatatagt attcaatatt atacatatag gaattgtgta ttttgtgttt ttagtatcta
      841 atgtataata gaaaacaata ataaagtaga atacgtatgt atacatacaa acatatta