Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248310 898 bp mRNA linear INV 02-SEP-2023 (LOC106084556), mRNA. ACCESSION XM_013248310 VERSION XM_013248310.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248310.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..898 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..898 /gene="LOC106084556" /note="protein twisted gastrulation; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084556" CDS 1..753 /gene="LOC106084556" /codon_start=1 /product="protein twisted gastrulation" /protein_id="XP_013103764.1" /db_xref="GeneID:106084556" /translation="MEILRSLTLGTLLLLAFIFFYSSVVESCNESVCAPIVSKCLLTQ SCKCELKNCSCCHECLKCLGKKFYEECCSCVELCPKPNDTMNFFSKKSHVEDFEGVPE LFNVLVSSPVDGLDWNIFTFQLDFDKVLSGPKMHSYPMENNDKNLDVAVKERDHMGTV NCTVIYLDQCTSWNKCRQSCQSTGASGYRWFHDGCCECVGSTCINYGLNESRCRNCPE PKDLGDDFDEDEDMQDFGDNMGPFDGSVNSNY" misc_feature 265..651 /gene="LOC106084556" /note="Twisted gastrulation (Tsg) protein conserved region; Region: Tsg; pfam04668" /db_xref="CDD:461385" polyA_site 898 /gene="LOC106084556" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atggagattt tgcggagttt aacgctaggc acattgttgc tacttgcatt tatatttttc 61 tacagttcag tggtcgagtc atgtaacgaa tccgtatgtg ctcccatcgt ttccaaatgt 121 ttgttgacac aaagttgtaa atgtgaatta aaaaattgtt cctgttgtca cgagtgtctc 181 aaatgtcttg gaaagaaatt ctacgaagaa tgttgcagtt gtgtggagct ttgccccaag 241 ccaaatgata ctatgaactt tttctctaaa aagtcccatg tggaagattt tgaaggtgta 301 cccgagcttt ttaatgttct tgtttcctct ccagtggatg gcttggattg gaatatattt 361 acattccaat tagattttga taaggtattg tctggtccaa aaatgcacag ttatcctatg 421 gaaaacaatg ataagaactt ggatgttgcc gtcaaagaac gtgaccatat gggaacagtg 481 aattgtactg ttatctatct cgatcaatgt acatcgtgga acaaatgtcg ccaaagctgt 541 caaagcaccg gcgcaagtgg ttataggtgg ttccacgatg gttgctgtga gtgtgttggc 601 tcaacatgca ttaattatgg actcaatgaa agtcgctgca gaaattgccc tgaacctaag 661 gatttgggtg atgacttcga tgaggacgag gatatgcaag atttcggcga taacatggga 721 ccgtttgacg gctctgtaaa tagcaactac taacccatgc agcagactct actcgatttt 781 tttatatagt attcaatatt atacatatag gaattgtgta ttttgtgttt ttagtatcta 841 atgtataata gaaaacaata ataaagtaga atacgtatgt atacatacaa acatatta