Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans survival motor neuron protein


LOCUS       XM_013248307             785 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084551), mRNA.
ACCESSION   XM_013248307
VERSION     XM_013248307.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248307.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..785
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..785
                     /gene="LOC106084551"
                     /note="survival motor neuron protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106084551"
     CDS             92..736
                     /gene="LOC106084551"
                     /codon_start=1
                     /product="survival motor neuron protein"
                     /protein_id="XP_013103761.1"
                     /db_xref="GeneID:106084551"
                     /translation="MSNPQGETKNTAEDPWDDTLLIKAYDDSVKLAREELARRISLST
                     SKAAADKDKSGDNKTDSKTNENVYKVGDYVRATFEDGIDYEGKIISIDQSAGTCLLKY
                     IGYENVQQVPLTELVASWGKKVRRLQFANAKLQAENSNNEYPSTSNKAAKKNKSKISK
                     SSMPPPPPIPPMLTASQNAEDSEHLSAMLMSWYMSGYYTGVYQGMQMAKSKEKN"
     misc_feature    131..718
                     /gene="LOC106084551"
                     /note="Survival motor neuron protein (SMN); Region: SMN;
                     pfam06003"
                     /db_xref="CDD:428716"
     misc_feature    293..457
                     /gene="LOC106084551"
                     /note="Tudor domain superfamily; Region: Tudor_SF;
                     cl02573"
                     /db_xref="CDD:470623"
     misc_feature    order(323..325,335..337,341..343,395..397,404..406,
                     410..412)
                     /gene="LOC106084551"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:410449"
     polyA_site      785
                     /gene="LOC106084551"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aattagaaaa attttgtttc gaaagttagc gacgtcgtta acttcattga ttgatttgtt
       61 tggctggaaa gtgatttgtt tatatcaaaa gatgtccaac ccgcaaggag aaacgaagaa
      121 tactgctgag gatccttggg atgatacgct tttgattaag gcctatgatg attcggttaa
      181 gctggccaga gaagaattgg cacgtcgtat ttcgctgtct acgagcaagg cggcggcgga
      241 taaggataaa agtggtgaca ataagaccga tagtaaaact aatgaaaatg tatataaagt
      301 tggcgattat gtacgcgcta ccttcgaaga tggcattgat tatgagggga aaataatatc
      361 aattgaccaa agcgctggaa cttgcctatt aaaatacatc ggctacgaaa acgtgcagca
      421 ggtaccgtta accgaacttg tagcttcttg gggcaaaaag gtacgccgtt tgcaatttgc
      481 taatgccaaa ctccaagcag aaaactcaaa taatgagtac ccaagcacaa gtaacaaggc
      541 agcaaagaaa aacaagtcga aaattagcaa gtcttctatg cctcctccac cacccattcc
      601 accaatgctg accgcatcgc aaaatgcaga agattcggaa catctttcgg caatgttaat
      661 gtcatggtat atgagtggat attatacagg ggtctatcag ggcatgcaaa tggcaaaatc
      721 caaggagaaa aattaagcgc ttatataggt gtatataccg attaataaat aacatataac
      781 aatta