Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248307 785 bp mRNA linear INV 02-SEP-2023 (LOC106084551), mRNA. ACCESSION XM_013248307 VERSION XM_013248307.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248307.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..785 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..785 /gene="LOC106084551" /note="survival motor neuron protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106084551" CDS 92..736 /gene="LOC106084551" /codon_start=1 /product="survival motor neuron protein" /protein_id="XP_013103761.1" /db_xref="GeneID:106084551" /translation="MSNPQGETKNTAEDPWDDTLLIKAYDDSVKLAREELARRISLST SKAAADKDKSGDNKTDSKTNENVYKVGDYVRATFEDGIDYEGKIISIDQSAGTCLLKY IGYENVQQVPLTELVASWGKKVRRLQFANAKLQAENSNNEYPSTSNKAAKKNKSKISK SSMPPPPPIPPMLTASQNAEDSEHLSAMLMSWYMSGYYTGVYQGMQMAKSKEKN" misc_feature 131..718 /gene="LOC106084551" /note="Survival motor neuron protein (SMN); Region: SMN; pfam06003" /db_xref="CDD:428716" misc_feature 293..457 /gene="LOC106084551" /note="Tudor domain superfamily; Region: Tudor_SF; cl02573" /db_xref="CDD:470623" misc_feature order(323..325,335..337,341..343,395..397,404..406, 410..412) /gene="LOC106084551" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:410449" polyA_site 785 /gene="LOC106084551" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aattagaaaa attttgtttc gaaagttagc gacgtcgtta acttcattga ttgatttgtt 61 tggctggaaa gtgatttgtt tatatcaaaa gatgtccaac ccgcaaggag aaacgaagaa 121 tactgctgag gatccttggg atgatacgct tttgattaag gcctatgatg attcggttaa 181 gctggccaga gaagaattgg cacgtcgtat ttcgctgtct acgagcaagg cggcggcgga 241 taaggataaa agtggtgaca ataagaccga tagtaaaact aatgaaaatg tatataaagt 301 tggcgattat gtacgcgcta ccttcgaaga tggcattgat tatgagggga aaataatatc 361 aattgaccaa agcgctggaa cttgcctatt aaaatacatc ggctacgaaa acgtgcagca 421 ggtaccgtta accgaacttg tagcttcttg gggcaaaaag gtacgccgtt tgcaatttgc 481 taatgccaaa ctccaagcag aaaactcaaa taatgagtac ccaagcacaa gtaacaaggc 541 agcaaagaaa aacaagtcga aaattagcaa gtcttctatg cctcctccac cacccattcc 601 accaatgctg accgcatcgc aaaatgcaga agattcggaa catctttcgg caatgttaat 661 gtcatggtat atgagtggat attatacagg ggtctatcag ggcatgcaaa tggcaaaatc 721 caaggagaaa aattaagcgc ttatataggt gtatataccg attaataaat aacatataac 781 aatta