Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248276 1375 bp mRNA linear INV 02-SEP-2023 (LOC106084534), transcript variant X5, mRNA. ACCESSION XM_013248276 VERSION XM_013248276.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248276.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1375 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1375 /gene="LOC106084534" /note="serine--tRNA ligase, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106084534" CDS 148..1368 /gene="LOC106084534" /codon_start=1 /product="serine--tRNA ligase, mitochondrial isoform X4" /protein_id="XP_013103730.2" /db_xref="GeneID:106084534" /translation="MKIPLRSFCAKPVCAIISEDLHHYGSTSNLDKMEQNVLLRKGSN NIPVIRELIKKLDMKNDSDVAKLKGELSKLPNLTHPRIVNYGDEPKELEQFSPSDSFP THATEFSEVAKYMNIFRMDHLGNYTGHKSYYLFGKLAELEQAIKEYTVQQLLQNNFSL ISVPDILPKEVIEGCGMNTDGERTQVYKLDSGLCLSGTSEMALAGFFENQVLEEKQLP IKVAAVSRCYRAETSGLNEEKGIYRVHQFTKVEMFAICAESQSEDVLELFKDLQLENF KKLNLKIRLLDMPPSELGAPAYQKYDIEAWMPGRKVWGEISSSSNCTDYQAKRLNIRY KTNKGETKFAHTVNGTAAAIPRLLIAILESNQVDKNSIEIPKVLGEYMKNCSITKDKL IPEIKLLKHLKHDI" polyA_site 1375 /gene="LOC106084534" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taaaaaaatt aaaaatttac cggaaaacaa agaagaagaa atatttaccg ttataactac 61 atacatacgt tgtaaaatat ccggtgtcca accacttttt cagagatatt taaacttgct 121 agtcccgtga cgcagaggtt taatcttatg aaaatacccc tgcgttcttt ctgtgccaaa 181 cctgtttgtg ccataatatc tgaagattta catcattatg gatctacctc taatttggac 241 aaaatggaac agaacgtctt gctgcgaaag ggctccaata atataccagt aatacgagag 301 ttaataaaga aattggatat gaaaaacgac tctgacgttg caaaactaaa gggggagctg 361 tcaaaactgc ccaatcttac acatcctaga attgtgaatt atggggatga acctaaggaa 421 ctggagcaat tctctccctc tgattctttt cccactcatg ctactgagtt ttctgaagta 481 gcaaagtata tgaatatctt ccgcatggac catttgggta attatacggg acacaaaagt 541 tattacttgt ttggaaaatt ggctgaacta gaacaagcta taaaggagta cacagttcaa 601 caattgttgc aaaataattt ttctttaatc tctgttcctg atattctgcc taaggaggtc 661 atagagggat gtggcatgaa taccgatggt gaaaggacac aagtttacaa acttgattct 721 ggattgtgct tgtctggcac ttctgagatg gctttggctg gtttcttcga aaatcaagta 781 ttagaagaaa agcaactgcc aattaaagtg gctgctgtaa gccgttgtta tagagcagaa 841 acgtcgggat taaacgagga aaagggtata tatagggtac atcaatttac aaaagttgaa 901 atgtttgcga tatgtgccga aagtcaatca gaagatgttc tggaactctt caaggatctg 961 caactggaaa attttaagaa gttaaactta aaaatacgtc tattagatat gccaccatca 1021 gaattgggtg ctccagccta tcaaaaatat gacatagaag cttggatgcc aggcagaaaa 1081 gtttggggag aaatttctag cagtagtaac tgcactgatt accaagcaaa acgactcaat 1141 ataagatata aaaccaataa gggtgagacc aaatttgccc atacagtaaa tggaacagca 1201 gctgccatac ctagattatt gatagcaata cttgaatcaa accaggttga taaaaattca 1261 attgagattc ctaaagtact tggtgaatac atgaagaatt gtagcattac aaaagataaa 1321 ttgataccag aaataaaatt gttaaagcat ttaaagcatg atatttaaag aaaca