Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans adenylate kinase isoenzyme 6 homolog


LOCUS       XM_013248264             598 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084529), mRNA.
ACCESSION   XM_013248264
VERSION     XM_013248264.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248264.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..598
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..598
                     /gene="LOC106084529"
                     /note="adenylate kinase isoenzyme 6 homolog; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:106084529"
     CDS             62..580
                     /gene="LOC106084529"
                     /codon_start=1
                     /product="adenylate kinase isoenzyme 6 homolog"
                     /protein_id="XP_013103718.2"
                     /db_xref="GeneID:106084529"
                     /translation="MADTLPNILVTGTPGVGKSYICQQIQEQLKLKWLDCSKIAKEKN
                     FIEEFDEEYDCPILDEDKLMDYMEPLMQEGGYLVEYHGCDFFPERWFNAVFVVTCSNN
                     TILYDRLKERNYNEKKLKSNLECEIFGTIMEEARDSYKPEIVFELKSETKKDAEKSLK
                     IVRDWLKKWKRK"
     polyA_site      598
                     /gene="LOC106084529"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtccccaca gctgaaaagg ctccatgccc tgctcctttc tttgaattct gtgttacgga
       61 gatggcggac actttgccta atatattggt aaccggcact cctggtgtgg gtaaatccta
      121 tatctgtcaa caaattcagg agcagctaaa acttaaatgg ttggattgct ctaaaatagc
      181 caaggagaaa aactttatcg aggaatttga tgaagagtat gattgtccca tattggatga
      241 agataaactt atggactaca tggaaccttt aatgcaagag ggcggctatc ttgtggaata
      301 tcatggttgt gatttttttc ccgaacgttg gtttaatgct gtgtttgtag tgacttgctc
      361 aaataatacc atactctatg atcgtttgaa ggaaaggaat tacaatgaaa aaaagttgaa
      421 atcaaattta gaatgtgaaa tattcggcac cataatggag gaggccagag actcgtataa
      481 accagaaata gttttcgaac tgaaaagtga aactaagaaa gatgctgaga aaagtttaaa
      541 aattgttaga gattggttga aaaaatggaa gagaaaataa aaaaggtaat ttttttta