Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248264 598 bp mRNA linear INV 02-SEP-2023 (LOC106084529), mRNA. ACCESSION XM_013248264 VERSION XM_013248264.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248264.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..598 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..598 /gene="LOC106084529" /note="adenylate kinase isoenzyme 6 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106084529" CDS 62..580 /gene="LOC106084529" /codon_start=1 /product="adenylate kinase isoenzyme 6 homolog" /protein_id="XP_013103718.2" /db_xref="GeneID:106084529" /translation="MADTLPNILVTGTPGVGKSYICQQIQEQLKLKWLDCSKIAKEKN FIEEFDEEYDCPILDEDKLMDYMEPLMQEGGYLVEYHGCDFFPERWFNAVFVVTCSNN TILYDRLKERNYNEKKLKSNLECEIFGTIMEEARDSYKPEIVFELKSETKKDAEKSLK IVRDWLKKWKRK" polyA_site 598 /gene="LOC106084529" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtccccaca gctgaaaagg ctccatgccc tgctcctttc tttgaattct gtgttacgga 61 gatggcggac actttgccta atatattggt aaccggcact cctggtgtgg gtaaatccta 121 tatctgtcaa caaattcagg agcagctaaa acttaaatgg ttggattgct ctaaaatagc 181 caaggagaaa aactttatcg aggaatttga tgaagagtat gattgtccca tattggatga 241 agataaactt atggactaca tggaaccttt aatgcaagag ggcggctatc ttgtggaata 301 tcatggttgt gatttttttc ccgaacgttg gtttaatgct gtgtttgtag tgacttgctc 361 aaataatacc atactctatg atcgtttgaa ggaaaggaat tacaatgaaa aaaagttgaa 421 atcaaattta gaatgtgaaa tattcggcac cataatggag gaggccagag actcgtataa 481 accagaaata gttttcgaac tgaaaagtga aactaagaaa gatgctgaga aaagtttaaa 541 aattgttaga gattggttga aaaaatggaa gagaaaataa aaaaggtaat ttttttta