Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248260 529 bp mRNA linear INV 02-SEP-2023 (LOC106084525), mRNA. ACCESSION XM_013248260 VERSION XM_013248260.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248260.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..529 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..529 /gene="LOC106084525" /note="large ribosomal subunit protein uL29; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins" /db_xref="GeneID:106084525" CDS 82..453 /gene="LOC106084525" /codon_start=1 /product="large ribosomal subunit protein uL29" /protein_id="XP_013103714.1" /db_xref="GeneID:106084525" /translation="MVKVKCSDLRTKDKKELTKQLDELKNELLVLRVAKVTGGAPSKL SKIRVVRKAIARVYIVMHQKQKENLRKVYKNKKYKPLDLRKKRTRAIRKALSPRDANR KTLKEIRKRSIYPQRKYAVKA" misc_feature 100..270 /gene="LOC106084525" /note="Ribosomal L29 protein; Region: Ribosomal_L29; pfam00831" /db_xref="CDD:459954" polyA_site 529 /gene="LOC106084525" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gctgcgtgct ataaaacggc aactgtcaga ttttgacatt taagcctgta aagattcttt 61 ttagcgtgag tggcagacaa aatggtgaaa gtcaagtgct ccgatttaag aaccaaggac 121 aagaaagagc tcacaaaaca gctcgatgag ctgaaaaatg agctcctggt tctacgtgtt 181 gctaaagtta ccggaggtgc tccctcaaag ctctccaaaa tccgtgtagt acgtaaagcc 241 attgcccgtg tttacattgt tatgcaccaa aagcaaaagg agaatttgcg caaggtttac 301 aagaacaaga aatacaagcc tttggatttg agaaaaaaga ggactcgtgc catccgcaag 361 gctttgtcgc ccagagacgc aaacagaaag acccttaaag aaatccgcaa gcggtctatt 421 tacccacaaa ggaagtatgc cgttaaagca taatttgatt tgatttgttg aacgtgtgta 481 taatacaacg ctaataaaca ccaataaaac aaaaaaaatc tctttcgta