Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans large ribosomal subunit protein uL29


LOCUS       XM_013248260             529 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084525), mRNA.
ACCESSION   XM_013248260
VERSION     XM_013248260.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248260.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..529
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..529
                     /gene="LOC106084525"
                     /note="large ribosomal subunit protein uL29; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 26 Proteins"
                     /db_xref="GeneID:106084525"
     CDS             82..453
                     /gene="LOC106084525"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL29"
                     /protein_id="XP_013103714.1"
                     /db_xref="GeneID:106084525"
                     /translation="MVKVKCSDLRTKDKKELTKQLDELKNELLVLRVAKVTGGAPSKL
                     SKIRVVRKAIARVYIVMHQKQKENLRKVYKNKKYKPLDLRKKRTRAIRKALSPRDANR
                     KTLKEIRKRSIYPQRKYAVKA"
     misc_feature    100..270
                     /gene="LOC106084525"
                     /note="Ribosomal L29 protein; Region: Ribosomal_L29;
                     pfam00831"
                     /db_xref="CDD:459954"
     polyA_site      529
                     /gene="LOC106084525"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gctgcgtgct ataaaacggc aactgtcaga ttttgacatt taagcctgta aagattcttt
       61 ttagcgtgag tggcagacaa aatggtgaaa gtcaagtgct ccgatttaag aaccaaggac
      121 aagaaagagc tcacaaaaca gctcgatgag ctgaaaaatg agctcctggt tctacgtgtt
      181 gctaaagtta ccggaggtgc tccctcaaag ctctccaaaa tccgtgtagt acgtaaagcc
      241 attgcccgtg tttacattgt tatgcaccaa aagcaaaagg agaatttgcg caaggtttac
      301 aagaacaaga aatacaagcc tttggatttg agaaaaaaga ggactcgtgc catccgcaag
      361 gctttgtcgc ccagagacgc aaacagaaag acccttaaag aaatccgcaa gcggtctatt
      421 tacccacaaa ggaagtatgc cgttaaagca taatttgatt tgatttgttg aacgtgtgta
      481 taatacaacg ctaataaaca ccaataaaac aaaaaaaatc tctttcgta