Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248259 491 bp mRNA linear INV 02-SEP-2023 (LOC106084524), mRNA. ACCESSION XM_013248259 VERSION XM_013248259.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248259.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..491 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..491 /gene="LOC106084524" /note="transmembrane protein 203; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106084524" CDS 1..423 /gene="LOC106084524" /codon_start=1 /product="transmembrane protein 203" /protein_id="XP_013103713.1" /db_xref="GeneID:106084524" /translation="MFKLSELVRWLGLTEFEIMVNLCGLLVFTITLAFRISGTIGKNT VDWFTIFSPLFCVDICNAYFCIIVLLRMYLDSDNKRKALHRFMWSTYFLFLVAIFKYL LCLKLSGQTKLEYSEVFSPIFVLLQLVAVRACQLPNSV" misc_feature 4..408 /gene="LOC106084524" /note="Transmembrane protein 203; Region: TMEM203; cd22816" /db_xref="CDD:439364" polyA_site 491 /gene="LOC106084524" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgtttaaat tatcggaact tgttcgttgg ctcggattga ccgaatttga gattatggtt 61 aatttgtgtg gtctgctcgt tttcaccata acacttgcat ttcgaatatc tggaactatt 121 ggaaaaaata ccgtcgattg gtttacaata tttagtccgc tgttttgtgt cgatatatgc 181 aatgcctact tttgtataat agtactattg cgtatgtatc tggattctga caacaaacgc 241 aaagcattac atcgttttat gtggagcact tattttcttt tcttggtggc tattttcaaa 301 tacttactat gtttgaaatt gagcggtcag actaagttgg aatacagtga ggtattctca 361 cccatctttg tattgcttca actcgtcgca gtacgagcat gtcaactgcc aaattctgta 421 taataatttc ttagaatact attttttatg catatatatt aataaataat aacgagaata 481 ctgagtctaa a