Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transmembrane protein 203


LOCUS       XM_013248259             491 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084524), mRNA.
ACCESSION   XM_013248259
VERSION     XM_013248259.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248259.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..491
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..491
                     /gene="LOC106084524"
                     /note="transmembrane protein 203; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106084524"
     CDS             1..423
                     /gene="LOC106084524"
                     /codon_start=1
                     /product="transmembrane protein 203"
                     /protein_id="XP_013103713.1"
                     /db_xref="GeneID:106084524"
                     /translation="MFKLSELVRWLGLTEFEIMVNLCGLLVFTITLAFRISGTIGKNT
                     VDWFTIFSPLFCVDICNAYFCIIVLLRMYLDSDNKRKALHRFMWSTYFLFLVAIFKYL
                     LCLKLSGQTKLEYSEVFSPIFVLLQLVAVRACQLPNSV"
     misc_feature    4..408
                     /gene="LOC106084524"
                     /note="Transmembrane protein 203; Region: TMEM203;
                     cd22816"
                     /db_xref="CDD:439364"
     polyA_site      491
                     /gene="LOC106084524"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgtttaaat tatcggaact tgttcgttgg ctcggattga ccgaatttga gattatggtt
       61 aatttgtgtg gtctgctcgt tttcaccata acacttgcat ttcgaatatc tggaactatt
      121 ggaaaaaata ccgtcgattg gtttacaata tttagtccgc tgttttgtgt cgatatatgc
      181 aatgcctact tttgtataat agtactattg cgtatgtatc tggattctga caacaaacgc
      241 aaagcattac atcgttttat gtggagcact tattttcttt tcttggtggc tattttcaaa
      301 tacttactat gtttgaaatt gagcggtcag actaagttgg aatacagtga ggtattctca
      361 cccatctttg tattgcttca actcgtcgca gtacgagcat gtcaactgcc aaattctgta
      421 taataatttc ttagaatact attttttatg catatatatt aataaataat aacgagaata
      481 ctgagtctaa a