PREDICTED: Stomoxys calcitrans ribonuclease P protein subunit p20

LOCUS       XM_013248258             488 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084523), mRNA.
ACCESSION   XM_013248258
VERSION     XM_013248258.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248258.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..488
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..488
                     /gene="LOC106084523"
                     /note="ribonuclease P protein subunit p20; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106084523"
     CDS             57..488
                     /gene="LOC106084523"
                     /codon_start=1
                     /product="ribonuclease P protein subunit p20"
                     /protein_id="XP_013103712.1"
                     /db_xref="GeneID:106084523"
                     /translation="MDNTNPNPKPQKRSLFNKKTHQQKKKPPNKPRKRQNDIYITTKS
                     NYKAQQKYCKDLLDSGLKEIYLHCLGNAINRGLNLALDLVNNSNDTLTYALNTSTIHL
                     TDEFHPLCDDEDVSIQKRNNSAVHIKIARNSAYDIDIACTL"
     misc_feature    159..440
                     /gene="LOC106084523"
                     /note="Rpp20 subunit of nuclear RNase MRP and P; Region:
                     Rpp20; pfam12328"
                     /db_xref="CDD:372048"
ORIGIN      
        1 tcgttttcaa cgtcttctat tcaatagctc cgacttcgat tttctgcatc caaattatgg
       61 acaataccaa tcccaatccg aagccacaaa aaagatccct attcaataaa aagacacatc
      121 aacaaaaaaa gaaaccacca aataaaccaa ggaagaggca aaacgacata tacatcacaa
      181 caaagtcgaa ttacaaggct caacaaaaat actgcaaaga tcttttggat tccggattaa
      241 aggaaatata tctgcattgc ttgggcaatg ccataaacag aggactaaat ttagcattag
      301 atttggtgaa caattccaac gacacattaa catacgcttt aaatacatca acgatacatc
      361 ttacagatga atttcatccc ctatgtgatg atgaggatgt ttcaatacaa aaaaggaata
      421 attctgcagt tcacataaaa atagcacgaa attcagccta cgacatcgac attgcctgta
      481 ctctgtga