Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084427


LOCUS       XM_013248105             749 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084427), mRNA.
ACCESSION   XM_013248105
VERSION     XM_013248105.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248105.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..749
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..749
                     /gene="LOC106084427"
                     /note="uncharacterized LOC106084427; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106084427"
     CDS             61..591
                     /gene="LOC106084427"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084427"
                     /protein_id="XP_013103559.2"
                     /db_xref="GeneID:106084427"
                     /translation="MSKFSEYFNSTTFKGRANVAKATYASFAAIYLYSRFRNKNRSSN
                     ENAKRNENANNQTQIEKPHLESPHSHNHVQYHNMKDNEASCNCECSKESEKLPKEDIK
                     ENGVIPSGVSPQQNQGANSLNGNDITNKRSIAVAAAVIQNSRAACESSDNIKEKTEFV
                     SFFPFDEERLIEWGFP"
     polyA_site      749
                     /gene="LOC106084427"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttctgacaat tgaacaaaaa tatattttaa tataattgct gtccaaaatt cctacacaaa
       61 atgtcgaaat tttccgaata ttttaatagc accacattca aagggcgtgc aaatgtggcc
      121 aaggcaacat acgcttcatt cgcagctatt tacttatata gccgttttcg caacaaaaat
      181 cgatcatcca atgaaaacgc taaaaggaat gaaaatgcta acaatcaaac tcaaattgag
      241 aaaccccatt tggagtcacc acacagccat aaccatgtgc agtatcataa catgaaagat
      301 aatgaggcat cttgcaattg tgaatgttct aaagaaagtg aaaaacttcc aaaagaggac
      361 ataaaggaaa atggtgtaat tccaagtggc gtttcacccc aacaaaacca gggagctaat
      421 agtttgaatg gaaatgatat tacaaataaa cgttcaatag ctgttgcagc agccgttata
      481 caaaactcaa gagctgcatg cgaatcttca gataatataa aagagaaaac ggaatttgtg
      541 tcattttttc ctttcgacga ggaaagattg atcgagtggg gatttccata atataagaac
      601 taagctttca atccttatca gcaatacaca cgggagccgc tgcacatgtt taccatgagc
      661 gtaaacattt agattatttt ttttttttaa taattgtaat aattttgaag cattaataaa
      721 gaaaaatgct ttatttttgg ctgagtcaa