Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248105 749 bp mRNA linear INV 02-SEP-2023 (LOC106084427), mRNA. ACCESSION XM_013248105 VERSION XM_013248105.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248105.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..749 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..749 /gene="LOC106084427" /note="uncharacterized LOC106084427; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106084427" CDS 61..591 /gene="LOC106084427" /codon_start=1 /product="uncharacterized protein LOC106084427" /protein_id="XP_013103559.2" /db_xref="GeneID:106084427" /translation="MSKFSEYFNSTTFKGRANVAKATYASFAAIYLYSRFRNKNRSSN ENAKRNENANNQTQIEKPHLESPHSHNHVQYHNMKDNEASCNCECSKESEKLPKEDIK ENGVIPSGVSPQQNQGANSLNGNDITNKRSIAVAAAVIQNSRAACESSDNIKEKTEFV SFFPFDEERLIEWGFP" polyA_site 749 /gene="LOC106084427" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttctgacaat tgaacaaaaa tatattttaa tataattgct gtccaaaatt cctacacaaa 61 atgtcgaaat tttccgaata ttttaatagc accacattca aagggcgtgc aaatgtggcc 121 aaggcaacat acgcttcatt cgcagctatt tacttatata gccgttttcg caacaaaaat 181 cgatcatcca atgaaaacgc taaaaggaat gaaaatgcta acaatcaaac tcaaattgag 241 aaaccccatt tggagtcacc acacagccat aaccatgtgc agtatcataa catgaaagat 301 aatgaggcat cttgcaattg tgaatgttct aaagaaagtg aaaaacttcc aaaagaggac 361 ataaaggaaa atggtgtaat tccaagtggc gtttcacccc aacaaaacca gggagctaat 421 agtttgaatg gaaatgatat tacaaataaa cgttcaatag ctgttgcagc agccgttata 481 caaaactcaa gagctgcatg cgaatcttca gataatataa aagagaaaac ggaatttgtg 541 tcattttttc ctttcgacga ggaaagattg atcgagtggg gatttccata atataagaac 601 taagctttca atccttatca gcaatacaca cgggagccgc tgcacatgtt taccatgagc 661 gtaaacattt agattatttt ttttttttaa taattgtaat aattttgaag cattaataaa 721 gaaaaatgct ttatttttgg ctgagtcaa