Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248099 705 bp mRNA linear INV 02-SEP-2023 (LOC106084421), transcript variant X9, mRNA. ACCESSION XM_013248099 VERSION XM_013248099.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248099.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..705 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..705 /gene="LOC106084421" /note="putative sulfiredoxin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084421" CDS 150..644 /gene="LOC106084421" /codon_start=1 /product="putative sulfiredoxin isoform X9" /protein_id="XP_013103553.1" /db_xref="GeneID:106084421" /translation="MLSTTATSCVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVK SIMETLESEKTSDNVPPIDVLWIKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVN STLSDLYTYMGSSTPKNLVQVLVWPKTNTDNNVQKHPKLYRTHQLKVAYIFCLHRPPE EFCF" misc_feature 213..488 /gene="LOC106084421" /note="Sulfiredoxin reactivates peroxiredoxins after oxidative inactivation; Region: Srx; cd16395" /db_xref="CDD:319253" misc_feature order(216..227,240..254,336..338,342..347,369..377, 384..389,438..440,447..452,465..467,474..479) /gene="LOC106084421" /note="peroxiredoxin binding site [polypeptide binding]; other site" /db_xref="CDD:319253" misc_feature order(273..275,282..287,294..296,321..323,327..329, 387..401) /gene="LOC106084421" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:319253" ORIGIN 1 aatttgtatg cagtaaaagt acatgttgga ttagtaactt ctaattttaa ataaccatga 61 acttgtgggc agggcattcg ctggcttatc attaaacaaa cagacatagt tgattactag 121 gtgctttcaa taatcattca accgcacaaa tgctttcaac cactgcaact tcttgtgtcg 181 atcgtagtgt acattcagcc aatatcgatg aaattcacaa tgtacctatg aatgtcattc 241 accggccaat acccccagtg ctagatgaaa acaaagtgaa atcaataatg gagaccttag 301 agagtgaaaa aacctccgat aatgtaccac cgatagatgt cttgtggatc aaggggtcga 361 agggaggaaa ctacttttat agttttggtg gttgtcatcg ttttgaggcc tataagcgtc 421 ttaaccgtga taccataaaa gcaaaactag taaattctac tctgtccgac ttgtacacct 481 atatgggatc gagtacaccc aaaaacttgg tccaagttct agtttggcca aaaacaaaca 541 ctgataacaa tgtacaaaaa catccaaaac tttatagaac tcaccaattg aaagtcgcat 601 acatattttg tttgcacaga ccaccggagg agttttgttt ctaaggagtg atgatgaatc 661 caaacataaa cctcaaactc atctgttaag aaagttcatc gcgcg