Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans putative sulfiredoxin


LOCUS       XM_013248099             705 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084421), transcript variant X9, mRNA.
ACCESSION   XM_013248099
VERSION     XM_013248099.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248099.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..705
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..705
                     /gene="LOC106084421"
                     /note="putative sulfiredoxin; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084421"
     CDS             150..644
                     /gene="LOC106084421"
                     /codon_start=1
                     /product="putative sulfiredoxin isoform X9"
                     /protein_id="XP_013103553.1"
                     /db_xref="GeneID:106084421"
                     /translation="MLSTTATSCVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVK
                     SIMETLESEKTSDNVPPIDVLWIKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVN
                     STLSDLYTYMGSSTPKNLVQVLVWPKTNTDNNVQKHPKLYRTHQLKVAYIFCLHRPPE
                     EFCF"
     misc_feature    213..488
                     /gene="LOC106084421"
                     /note="Sulfiredoxin reactivates peroxiredoxins after
                     oxidative inactivation; Region: Srx; cd16395"
                     /db_xref="CDD:319253"
     misc_feature    order(216..227,240..254,336..338,342..347,369..377,
                     384..389,438..440,447..452,465..467,474..479)
                     /gene="LOC106084421"
                     /note="peroxiredoxin binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:319253"
     misc_feature    order(273..275,282..287,294..296,321..323,327..329,
                     387..401)
                     /gene="LOC106084421"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:319253"
ORIGIN      
        1 aatttgtatg cagtaaaagt acatgttgga ttagtaactt ctaattttaa ataaccatga
       61 acttgtgggc agggcattcg ctggcttatc attaaacaaa cagacatagt tgattactag
      121 gtgctttcaa taatcattca accgcacaaa tgctttcaac cactgcaact tcttgtgtcg
      181 atcgtagtgt acattcagcc aatatcgatg aaattcacaa tgtacctatg aatgtcattc
      241 accggccaat acccccagtg ctagatgaaa acaaagtgaa atcaataatg gagaccttag
      301 agagtgaaaa aacctccgat aatgtaccac cgatagatgt cttgtggatc aaggggtcga
      361 agggaggaaa ctacttttat agttttggtg gttgtcatcg ttttgaggcc tataagcgtc
      421 ttaaccgtga taccataaaa gcaaaactag taaattctac tctgtccgac ttgtacacct
      481 atatgggatc gagtacaccc aaaaacttgg tccaagttct agtttggcca aaaacaaaca
      541 ctgataacaa tgtacaaaaa catccaaaac tttatagaac tcaccaattg aaagtcgcat
      601 acatattttg tttgcacaga ccaccggagg agttttgttt ctaaggagtg atgatgaatc
      661 caaacataaa cctcaaactc atctgttaag aaagttcatc gcgcg