Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248097 901 bp mRNA linear INV 02-SEP-2023 (LOC106084421), transcript variant X8, mRNA. ACCESSION XM_013248097 VERSION XM_013248097.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..901 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..901 /gene="LOC106084421" /note="putative sulfiredoxin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084421" CDS 343..867 /gene="LOC106084421" /codon_start=1 /product="putative sulfiredoxin isoform X8" /protein_id="XP_013103551.1" /db_xref="GeneID:106084421" /translation="MELIAKFVLPASRRVLFFAKPTTVAVIFLLVGLLGAFNNHSTAQ MLSTTATSCVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDN VPPIDVLWIKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSST PKNLLYVLFFLHLN" misc_feature 538..813 /gene="LOC106084421" /note="Sulfiredoxin reactivates peroxiredoxins after oxidative inactivation; Region: Srx; cd16395" /db_xref="CDD:319253" misc_feature order(541..552,565..579,661..663,667..672,694..702, 709..714,763..765,772..777,790..792,799..804) /gene="LOC106084421" /note="peroxiredoxin binding site [polypeptide binding]; other site" /db_xref="CDD:319253" misc_feature order(598..600,607..612,619..621,646..648,652..654, 712..726) /gene="LOC106084421" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:319253" ORIGIN 1 cgctggcaat ttattgattt aatatgcaaa ataaagattt ctttgtttgt tatttttgat 61 tcgaaataaa tttaagatta tttgggtgca agagaggcgg tgcagaaaca ttcatacttg 121 cctgcatgta catacatatg tacgccagac agcgatacat ttaaaacaac atcacacacc 181 acttgtctac cacagtccct cctagaccac gacctatgga aaatataaat aaaaatcgcg 241 agttgttaaa caaagagaac caaacaacgc aataacaaaa caagttctag gagtactggc 301 ggtgttgtag agcattttgg cgatttcgtt gaacgtcttg gaatggagct tattgctaag 361 tttgttttgc cagcgagtag acgtgttttg tttttcgcta agcccacgac agtggctgtt 421 attttcttac tcgtaggatt actaggtgct ttcaataatc attcaaccgc acaaatgctt 481 tcaaccactg caacttcttg tgtcgatcgt agtgtacatt cagccaatat cgatgaaatt 541 cacaatgtac ctatgaatgt cattcaccgg ccaatacccc cagtgctaga tgaaaacaaa 601 gtgaaatcaa taatggagac cttagagagt gaaaaaacct ccgataatgt accaccgata 661 gatgtcttgt ggatcaaggg gtcgaaggga ggaaactact tttatagttt tggtggttgt 721 catcgttttg aggcctataa gcgtcttaac cgtgatacca taaaagcaaa actagtaaat 781 tctactctgt ccgacttgta cacctatatg ggatcgagta cacccaaaaa cttgctttat 841 gttttatttt ttctacatct aaattaaaat gataggtcca agttctagtt tggccaaaaa 901 c