Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans putative sulfiredoxin


LOCUS       XM_013248097             901 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084421), transcript variant X8, mRNA.
ACCESSION   XM_013248097
VERSION     XM_013248097.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..901
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..901
                     /gene="LOC106084421"
                     /note="putative sulfiredoxin; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084421"
     CDS             343..867
                     /gene="LOC106084421"
                     /codon_start=1
                     /product="putative sulfiredoxin isoform X8"
                     /protein_id="XP_013103551.1"
                     /db_xref="GeneID:106084421"
                     /translation="MELIAKFVLPASRRVLFFAKPTTVAVIFLLVGLLGAFNNHSTAQ
                     MLSTTATSCVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDN
                     VPPIDVLWIKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSST
                     PKNLLYVLFFLHLN"
     misc_feature    538..813
                     /gene="LOC106084421"
                     /note="Sulfiredoxin reactivates peroxiredoxins after
                     oxidative inactivation; Region: Srx; cd16395"
                     /db_xref="CDD:319253"
     misc_feature    order(541..552,565..579,661..663,667..672,694..702,
                     709..714,763..765,772..777,790..792,799..804)
                     /gene="LOC106084421"
                     /note="peroxiredoxin binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:319253"
     misc_feature    order(598..600,607..612,619..621,646..648,652..654,
                     712..726)
                     /gene="LOC106084421"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:319253"
ORIGIN      
        1 cgctggcaat ttattgattt aatatgcaaa ataaagattt ctttgtttgt tatttttgat
       61 tcgaaataaa tttaagatta tttgggtgca agagaggcgg tgcagaaaca ttcatacttg
      121 cctgcatgta catacatatg tacgccagac agcgatacat ttaaaacaac atcacacacc
      181 acttgtctac cacagtccct cctagaccac gacctatgga aaatataaat aaaaatcgcg
      241 agttgttaaa caaagagaac caaacaacgc aataacaaaa caagttctag gagtactggc
      301 ggtgttgtag agcattttgg cgatttcgtt gaacgtcttg gaatggagct tattgctaag
      361 tttgttttgc cagcgagtag acgtgttttg tttttcgcta agcccacgac agtggctgtt
      421 attttcttac tcgtaggatt actaggtgct ttcaataatc attcaaccgc acaaatgctt
      481 tcaaccactg caacttcttg tgtcgatcgt agtgtacatt cagccaatat cgatgaaatt
      541 cacaatgtac ctatgaatgt cattcaccgg ccaatacccc cagtgctaga tgaaaacaaa
      601 gtgaaatcaa taatggagac cttagagagt gaaaaaacct ccgataatgt accaccgata
      661 gatgtcttgt ggatcaaggg gtcgaaggga ggaaactact tttatagttt tggtggttgt
      721 catcgttttg aggcctataa gcgtcttaac cgtgatacca taaaagcaaa actagtaaat
      781 tctactctgt ccgacttgta cacctatatg ggatcgagta cacccaaaaa cttgctttat
      841 gttttatttt ttctacatct aaattaaaat gataggtcca agttctagtt tggccaaaaa
      901 c