Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans putative sulfiredoxin


LOCUS       XM_013248095             714 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084421), transcript variant X6, mRNA.
ACCESSION   XM_013248095
VERSION     XM_013248095.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248095.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..714
                     /gene="LOC106084421"
                     /note="putative sulfiredoxin; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084421"
     CDS             89..655
                     /gene="LOC106084421"
                     /codon_start=1
                     /product="putative sulfiredoxin isoform X6"
                     /protein_id="XP_013103549.1"
                     /db_xref="GeneID:106084421"
                     /translation="MTKPWEFSLVQGLLGAFNNHSTAQMLSTTATSCVDRSVHSANID
                     EIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDNVPPIDVLWIKGSKGGNYFYS
                     FGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSSTPKNLVQVLVWPKTNTDNNVQ
                     KHPKLYRTHQLKVAYIFCLHRPPEEFCF"
     misc_feature    224..499
                     /gene="LOC106084421"
                     /note="Sulfiredoxin reactivates peroxiredoxins after
                     oxidative inactivation; Region: Srx; cd16395"
                     /db_xref="CDD:319253"
     misc_feature    order(227..238,251..265,347..349,353..358,380..388,
                     395..400,449..451,458..463,476..478,485..490)
                     /gene="LOC106084421"
                     /note="peroxiredoxin binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:319253"
     misc_feature    order(284..286,293..298,305..307,332..334,338..340,
                     398..412)
                     /gene="LOC106084421"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:319253"
ORIGIN      
        1 tcattgtatt gtacaataga ttgtgacaat cggacaatca tcccaaatgg gatgaagcca
       61 gcagcaaata aaactacatt atccatgcat gacaaaacct tgggagtttt ctttggttca
      121 gggattacta ggtgctttca ataatcattc aaccgcacaa atgctttcaa ccactgcaac
      181 ttcttgtgtc gatcgtagtg tacattcagc caatatcgat gaaattcaca atgtacctat
      241 gaatgtcatt caccggccaa tacccccagt gctagatgaa aacaaagtga aatcaataat
      301 ggagacctta gagagtgaaa aaacctccga taatgtacca ccgatagatg tcttgtggat
      361 caaggggtcg aagggaggaa actactttta tagttttggt ggttgtcatc gttttgaggc
      421 ctataagcgt cttaaccgtg ataccataaa agcaaaacta gtaaattcta ctctgtccga
      481 cttgtacacc tatatgggat cgagtacacc caaaaacttg gtccaagttc tagtttggcc
      541 aaaaacaaac actgataaca atgtacaaaa acatccaaaa ctttatagaa ctcaccaatt
      601 gaaagtcgca tacatatttt gtttgcacag accaccggag gagttttgtt tctaaggagt
      661 gatgatgaat ccaaacataa acctcaaact catctgttaa gaaagttcat cgcg