Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248095 714 bp mRNA linear INV 02-SEP-2023 (LOC106084421), transcript variant X6, mRNA. ACCESSION XM_013248095 VERSION XM_013248095.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248095.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..714 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..714 /gene="LOC106084421" /note="putative sulfiredoxin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084421" CDS 89..655 /gene="LOC106084421" /codon_start=1 /product="putative sulfiredoxin isoform X6" /protein_id="XP_013103549.1" /db_xref="GeneID:106084421" /translation="MTKPWEFSLVQGLLGAFNNHSTAQMLSTTATSCVDRSVHSANID EIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDNVPPIDVLWIKGSKGGNYFYS FGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSSTPKNLVQVLVWPKTNTDNNVQ KHPKLYRTHQLKVAYIFCLHRPPEEFCF" misc_feature 224..499 /gene="LOC106084421" /note="Sulfiredoxin reactivates peroxiredoxins after oxidative inactivation; Region: Srx; cd16395" /db_xref="CDD:319253" misc_feature order(227..238,251..265,347..349,353..358,380..388, 395..400,449..451,458..463,476..478,485..490) /gene="LOC106084421" /note="peroxiredoxin binding site [polypeptide binding]; other site" /db_xref="CDD:319253" misc_feature order(284..286,293..298,305..307,332..334,338..340, 398..412) /gene="LOC106084421" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:319253" ORIGIN 1 tcattgtatt gtacaataga ttgtgacaat cggacaatca tcccaaatgg gatgaagcca 61 gcagcaaata aaactacatt atccatgcat gacaaaacct tgggagtttt ctttggttca 121 gggattacta ggtgctttca ataatcattc aaccgcacaa atgctttcaa ccactgcaac 181 ttcttgtgtc gatcgtagtg tacattcagc caatatcgat gaaattcaca atgtacctat 241 gaatgtcatt caccggccaa tacccccagt gctagatgaa aacaaagtga aatcaataat 301 ggagacctta gagagtgaaa aaacctccga taatgtacca ccgatagatg tcttgtggat 361 caaggggtcg aagggaggaa actactttta tagttttggt ggttgtcatc gttttgaggc 421 ctataagcgt cttaaccgtg ataccataaa agcaaaacta gtaaattcta ctctgtccga 481 cttgtacacc tatatgggat cgagtacacc caaaaacttg gtccaagttc tagtttggcc 541 aaaaacaaac actgataaca atgtacaaaa acatccaaaa ctttatagaa ctcaccaatt 601 gaaagtcgca tacatatttt gtttgcacag accaccggag gagttttgtt tctaaggagt 661 gatgatgaat ccaaacataa acctcaaact catctgttaa gaaagttcat cgcg