Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248094 996 bp mRNA linear INV 02-SEP-2023 (LOC106084421), transcript variant X4, mRNA. ACCESSION XM_013248094 VERSION XM_013248094.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248094.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..996 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..996 /gene="LOC106084421" /note="putative sulfiredoxin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084421" CDS 343..945 /gene="LOC106084421" /codon_start=1 /product="putative sulfiredoxin isoform X4" /protein_id="XP_013103548.1" /db_xref="GeneID:106084421" /translation="MELIAKFVLPASRRVLFFAKPTTGLLGAFNNHSTAQMLSTTATS CVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDNVPPIDVLW IKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSSTPKNLVQVL VWPKTNTDNNVQKHPKLYRTHQLKVAYIFCLHRPPEEFCF" misc_feature 514..789 /gene="LOC106084421" /note="Sulfiredoxin reactivates peroxiredoxins after oxidative inactivation; Region: Srx; cd16395" /db_xref="CDD:319253" misc_feature order(517..528,541..555,637..639,643..648,670..678, 685..690,739..741,748..753,766..768,775..780) /gene="LOC106084421" /note="peroxiredoxin binding site [polypeptide binding]; other site" /db_xref="CDD:319253" misc_feature order(574..576,583..588,595..597,622..624,628..630, 688..702) /gene="LOC106084421" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:319253" ORIGIN 1 cgctggcaat ttattgattt aatatgcaaa ataaagattt ctttgtttgt tatttttgat 61 tcgaaataaa tttaagatta tttgggtgca agagaggcgg tgcagaaaca ttcatacttg 121 cctgcatgta catacatatg tacgccagac agcgatacat ttaaaacaac atcacacacc 181 acttgtctac cacagtccct cctagaccac gacctatgga aaatataaat aaaaatcgcg 241 agttgttaaa caaagagaac caaacaacgc aataacaaaa caagttctag gagtactggc 301 ggtgttgtag agcattttgg cgatttcgtt gaacgtcttg gaatggagct tattgctaag 361 tttgttttgc cagcgagtag acgtgttttg tttttcgcta agcccacgac aggattacta 421 ggtgctttca ataatcattc aaccgcacaa atgctttcaa ccactgcaac ttcttgtgtc 481 gatcgtagtg tacattcagc caatatcgat gaaattcaca atgtacctat gaatgtcatt 541 caccggccaa tacccccagt gctagatgaa aacaaagtga aatcaataat ggagacctta 601 gagagtgaaa aaacctccga taatgtacca ccgatagatg tcttgtggat caaggggtcg 661 aagggaggaa actactttta tagttttggt ggttgtcatc gttttgaggc ctataagcgt 721 cttaaccgtg ataccataaa agcaaaacta gtaaattcta ctctgtccga cttgtacacc 781 tatatgggat cgagtacacc caaaaacttg gtccaagttc tagtttggcc aaaaacaaac 841 actgataaca atgtacaaaa acatccaaaa ctttatagaa ctcaccaatt gaaagtcgca 901 tacatatttt gtttgcacag accaccggag gagttttgtt tctaaggagt gatgatgaat 961 ccaaacataa acctcaaact catctgttaa gaaagt