Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans putative sulfiredoxin


LOCUS       XM_013248094             996 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084421), transcript variant X4, mRNA.
ACCESSION   XM_013248094
VERSION     XM_013248094.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248094.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..996
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..996
                     /gene="LOC106084421"
                     /note="putative sulfiredoxin; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084421"
     CDS             343..945
                     /gene="LOC106084421"
                     /codon_start=1
                     /product="putative sulfiredoxin isoform X4"
                     /protein_id="XP_013103548.1"
                     /db_xref="GeneID:106084421"
                     /translation="MELIAKFVLPASRRVLFFAKPTTGLLGAFNNHSTAQMLSTTATS
                     CVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDNVPPIDVLW
                     IKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSSTPKNLVQVL
                     VWPKTNTDNNVQKHPKLYRTHQLKVAYIFCLHRPPEEFCF"
     misc_feature    514..789
                     /gene="LOC106084421"
                     /note="Sulfiredoxin reactivates peroxiredoxins after
                     oxidative inactivation; Region: Srx; cd16395"
                     /db_xref="CDD:319253"
     misc_feature    order(517..528,541..555,637..639,643..648,670..678,
                     685..690,739..741,748..753,766..768,775..780)
                     /gene="LOC106084421"
                     /note="peroxiredoxin binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:319253"
     misc_feature    order(574..576,583..588,595..597,622..624,628..630,
                     688..702)
                     /gene="LOC106084421"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:319253"
ORIGIN      
        1 cgctggcaat ttattgattt aatatgcaaa ataaagattt ctttgtttgt tatttttgat
       61 tcgaaataaa tttaagatta tttgggtgca agagaggcgg tgcagaaaca ttcatacttg
      121 cctgcatgta catacatatg tacgccagac agcgatacat ttaaaacaac atcacacacc
      181 acttgtctac cacagtccct cctagaccac gacctatgga aaatataaat aaaaatcgcg
      241 agttgttaaa caaagagaac caaacaacgc aataacaaaa caagttctag gagtactggc
      301 ggtgttgtag agcattttgg cgatttcgtt gaacgtcttg gaatggagct tattgctaag
      361 tttgttttgc cagcgagtag acgtgttttg tttttcgcta agcccacgac aggattacta
      421 ggtgctttca ataatcattc aaccgcacaa atgctttcaa ccactgcaac ttcttgtgtc
      481 gatcgtagtg tacattcagc caatatcgat gaaattcaca atgtacctat gaatgtcatt
      541 caccggccaa tacccccagt gctagatgaa aacaaagtga aatcaataat ggagacctta
      601 gagagtgaaa aaacctccga taatgtacca ccgatagatg tcttgtggat caaggggtcg
      661 aagggaggaa actactttta tagttttggt ggttgtcatc gttttgaggc ctataagcgt
      721 cttaaccgtg ataccataaa agcaaaacta gtaaattcta ctctgtccga cttgtacacc
      781 tatatgggat cgagtacacc caaaaacttg gtccaagttc tagtttggcc aaaaacaaac
      841 actgataaca atgtacaaaa acatccaaaa ctttatagaa ctcaccaatt gaaagtcgca
      901 tacatatttt gtttgcacag accaccggag gagttttgtt tctaaggagt gatgatgaat
      961 ccaaacataa acctcaaact catctgttaa gaaagt