Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013248092 1033 bp mRNA linear INV 02-SEP-2023 (LOC106084421), transcript variant X1, mRNA. ACCESSION XM_013248092 VERSION XM_013248092.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013248092.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1033 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1033 /gene="LOC106084421" /note="putative sulfiredoxin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084421" CDS 350..976 /gene="LOC106084421" /codon_start=1 /product="putative sulfiredoxin isoform X1" /protein_id="XP_013103546.1" /db_xref="GeneID:106084421" /translation="MELIAKFVLPASRRVLFFAKPTTVAVIFLLVGLLGAFNNHSTAQ MLSTTATSCVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDN VPPIDVLWIKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSST PKNLVQVLVWPKTNTDNNVQKHPKLYRTHQLKVAYIFCLHRPPEEFCF" misc_feature 545..820 /gene="LOC106084421" /note="Sulfiredoxin reactivates peroxiredoxins after oxidative inactivation; Region: Srx; cd16395" /db_xref="CDD:319253" misc_feature order(548..559,572..586,668..670,674..679,701..709, 716..721,770..772,779..784,797..799,806..811) /gene="LOC106084421" /note="peroxiredoxin binding site [polypeptide binding]; other site" /db_xref="CDD:319253" misc_feature order(605..607,614..619,626..628,653..655,659..661, 719..733) /gene="LOC106084421" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:319253" ORIGIN 1 atgaatacgc tggcaattta ttgatttaat atgcaaaata aagatttctt tgtttgttat 61 ttttgattcg aaataaattt aagattattt gggtgcaaga gaggcggtgc agaaacattc 121 atacttgcct gcatgtacat acatatgtac gccagacagc gatacattta aaacaacatc 181 acacaccact tgtctaccac agtccctcct agaccacgac ctatggaaaa tataaataaa 241 aatcgcgagt tgttaaacaa agagaaccaa acaacgcaat aacaaaacaa gttctaggag 301 tactggcggt gttgtagagc attttggcga tttcgttgaa cgtcttggaa tggagcttat 361 tgctaagttt gttttgccag cgagtagacg tgttttgttt ttcgctaagc ccacgacagt 421 ggctgttatt ttcttactcg taggattact aggtgctttc aataatcatt caaccgcaca 481 aatgctttca accactgcaa cttcttgtgt cgatcgtagt gtacattcag ccaatatcga 541 tgaaattcac aatgtaccta tgaatgtcat tcaccggcca atacccccag tgctagatga 601 aaacaaagtg aaatcaataa tggagacctt agagagtgaa aaaacctccg ataatgtacc 661 accgatagat gtcttgtgga tcaaggggtc gaagggagga aactactttt atagttttgg 721 tggttgtcat cgttttgagg cctataagcg tcttaaccgt gataccataa aagcaaaact 781 agtaaattct actctgtccg acttgtacac ctatatggga tcgagtacac ccaaaaactt 841 ggtccaagtt ctagtttggc caaaaacaaa cactgataac aatgtacaaa aacatccaaa 901 actttataga actcaccaat tgaaagtcgc atacatattt tgtttgcaca gaccaccgga 961 ggagttttgt ttctaaggag tgatgatgaa tccaaacata aacctcaaac tcatctgtta 1021 agaaagttca tcg