Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans putative sulfiredoxin


LOCUS       XM_013248092            1033 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084421), transcript variant X1, mRNA.
ACCESSION   XM_013248092
VERSION     XM_013248092.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013248092.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1033
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1033
                     /gene="LOC106084421"
                     /note="putative sulfiredoxin; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084421"
     CDS             350..976
                     /gene="LOC106084421"
                     /codon_start=1
                     /product="putative sulfiredoxin isoform X1"
                     /protein_id="XP_013103546.1"
                     /db_xref="GeneID:106084421"
                     /translation="MELIAKFVLPASRRVLFFAKPTTVAVIFLLVGLLGAFNNHSTAQ
                     MLSTTATSCVDRSVHSANIDEIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDN
                     VPPIDVLWIKGSKGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSST
                     PKNLVQVLVWPKTNTDNNVQKHPKLYRTHQLKVAYIFCLHRPPEEFCF"
     misc_feature    545..820
                     /gene="LOC106084421"
                     /note="Sulfiredoxin reactivates peroxiredoxins after
                     oxidative inactivation; Region: Srx; cd16395"
                     /db_xref="CDD:319253"
     misc_feature    order(548..559,572..586,668..670,674..679,701..709,
                     716..721,770..772,779..784,797..799,806..811)
                     /gene="LOC106084421"
                     /note="peroxiredoxin binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:319253"
     misc_feature    order(605..607,614..619,626..628,653..655,659..661,
                     719..733)
                     /gene="LOC106084421"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:319253"
ORIGIN      
        1 atgaatacgc tggcaattta ttgatttaat atgcaaaata aagatttctt tgtttgttat
       61 ttttgattcg aaataaattt aagattattt gggtgcaaga gaggcggtgc agaaacattc
      121 atacttgcct gcatgtacat acatatgtac gccagacagc gatacattta aaacaacatc
      181 acacaccact tgtctaccac agtccctcct agaccacgac ctatggaaaa tataaataaa
      241 aatcgcgagt tgttaaacaa agagaaccaa acaacgcaat aacaaaacaa gttctaggag
      301 tactggcggt gttgtagagc attttggcga tttcgttgaa cgtcttggaa tggagcttat
      361 tgctaagttt gttttgccag cgagtagacg tgttttgttt ttcgctaagc ccacgacagt
      421 ggctgttatt ttcttactcg taggattact aggtgctttc aataatcatt caaccgcaca
      481 aatgctttca accactgcaa cttcttgtgt cgatcgtagt gtacattcag ccaatatcga
      541 tgaaattcac aatgtaccta tgaatgtcat tcaccggcca atacccccag tgctagatga
      601 aaacaaagtg aaatcaataa tggagacctt agagagtgaa aaaacctccg ataatgtacc
      661 accgatagat gtcttgtgga tcaaggggtc gaagggagga aactactttt atagttttgg
      721 tggttgtcat cgttttgagg cctataagcg tcttaaccgt gataccataa aagcaaaact
      781 agtaaattct actctgtccg acttgtacac ctatatggga tcgagtacac ccaaaaactt
      841 ggtccaagtt ctagtttggc caaaaacaaa cactgataac aatgtacaaa aacatccaaa
      901 actttataga actcaccaat tgaaagtcgc atacatattt tgtttgcaca gaccaccgga
      961 ggagttttgt ttctaaggag tgatgatgaa tccaaacata aacctcaaac tcatctgtta
     1021 agaaagttca tcg