Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084282


LOCUS       XM_013247855             519 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084282), mRNA.
ACCESSION   XM_013247855
VERSION     XM_013247855.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247855.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..519
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..519
                     /gene="LOC106084282"
                     /note="uncharacterized LOC106084282; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106084282"
     CDS             30..461
                     /gene="LOC106084282"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084282"
                     /protein_id="XP_013103309.2"
                     /db_xref="GeneID:106084282"
                     /translation="MKLYALLVIVAAVGCAQARCKPGDLPKATATCLQKTKAMEIDIL
                     DLLLLKNARNDNAKCFRSCLMTECEFMDEKGNIVPELSKIGGNLLGGGDPARSSVIEA
                     AISYCLTDTKFKGDSCDFVENLFLCSVNKCKECKITLPKLA"
     polyA_site      519
                     /gene="LOC106084282"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttaaacgc gcgctcgctt gttggcagaa tgaaattgta cgctttactg gttattgtag
       61 ctgctgtggg ctgtgcccag gctcgatgta aaccagggga tcttcctaaa gcaactgcca
      121 cctgtttgca gaagacaaaa gcaatggaaa ttgatattct tgatttgctg ttactcaaaa
      181 atgctcgtaa tgataatgcc aaatgttttc gatcgtgtct tatgactgaa tgtgaattta
      241 tggatgagaa aggaaacatt gtaccagaat tatctaaaat cggaggcaat cttctaggtg
      301 gtggagaccc agcgagaagc tcagtcatag aagctgccat tagttattgt ttgacggata
      361 caaaattcaa aggagatagt tgtgattttg ttgaaaattt atttttgtgt tctgtcaaca
      421 aatgcaaaga atgcaaaata actttgccaa aattggcata agtataaatt gtttttattt
      481 taacttttta tatcaataaa ccatttaatg ctatatcta