Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247855 519 bp mRNA linear INV 02-SEP-2023 (LOC106084282), mRNA. ACCESSION XM_013247855 VERSION XM_013247855.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247855.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..519 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..519 /gene="LOC106084282" /note="uncharacterized LOC106084282; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106084282" CDS 30..461 /gene="LOC106084282" /codon_start=1 /product="uncharacterized protein LOC106084282" /protein_id="XP_013103309.2" /db_xref="GeneID:106084282" /translation="MKLYALLVIVAAVGCAQARCKPGDLPKATATCLQKTKAMEIDIL DLLLLKNARNDNAKCFRSCLMTECEFMDEKGNIVPELSKIGGNLLGGGDPARSSVIEA AISYCLTDTKFKGDSCDFVENLFLCSVNKCKECKITLPKLA" polyA_site 519 /gene="LOC106084282" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttttaaacgc gcgctcgctt gttggcagaa tgaaattgta cgctttactg gttattgtag 61 ctgctgtggg ctgtgcccag gctcgatgta aaccagggga tcttcctaaa gcaactgcca 121 cctgtttgca gaagacaaaa gcaatggaaa ttgatattct tgatttgctg ttactcaaaa 181 atgctcgtaa tgataatgcc aaatgttttc gatcgtgtct tatgactgaa tgtgaattta 241 tggatgagaa aggaaacatt gtaccagaat tatctaaaat cggaggcaat cttctaggtg 301 gtggagaccc agcgagaagc tcagtcatag aagctgccat tagttattgt ttgacggata 361 caaaattcaa aggagatagt tgtgattttg ttgaaaattt atttttgtgt tctgtcaaca 421 aatgcaaaga atgcaaaata actttgccaa aattggcata agtataaatt gtttttattt 481 taacttttta tatcaataaa ccatttaatg ctatatcta