PREDICTED: Stomoxys calcitrans small ribosomal subunit protein

LOCUS       XM_013247776             568 bp    mRNA    linear   INV 02-SEP-2023
            uS12m (LOC106084226), mRNA.
ACCESSION   XM_013247776
VERSION     XM_013247776.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247776.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..568
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..568
                     /gene="LOC106084226"
                     /note="small ribosomal subunit protein uS12m; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106084226"
     CDS             121..537
                     /gene="LOC106084226"
                     /codon_start=1
                     /product="small ribosomal subunit protein uS12m"
                     /protein_id="XP_013103230.1"
                     /db_xref="GeneID:106084226"
                     /translation="MNFLRQTLNVTKQWTTQAVHNSFVQMREMASLYQMHRTGPHVKK
                     RPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQ
                     EHNIVLCRVGRVQDVPGVKLKCVRGVYDLNHVVKNK"
     misc_feature    211..528
                     /gene="LOC106084226"
                     /note="S12-like family, 30S ribosomal protein S12
                     subfamily; S12 is located at the interface of the large
                     and small ribosomal subunits of prokaryotes, chloroplasts
                     and mitochondria, where it plays an important role in both
                     tRNA and ribosomal subunit...; Region: Ribosomal_S12;
                     cd03368"
                     /db_xref="CDD:239466"
     misc_feature    order(214..219,223..228,235..240)
                     /gene="LOC106084226"
                     /note="S17 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239466"
     misc_feature    214..216
                     /gene="LOC106084226"
                     /note="S8 interaction site [active]"
                     /db_xref="CDD:239466"
     misc_feature    order(238..246,277..279,283..288,292..294,337..342,
                     346..354,373..375,397..399,406..411,448..453,463..468)
                     /gene="LOC106084226"
                     /note="16S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(328..333,463..465)
                     /gene="LOC106084226"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    331..336
                     /gene="LOC106084226"
                     /note="23S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(334..351,409..435)
                     /gene="LOC106084226"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239466"
     polyA_site      568
                     /gene="LOC106084226"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tggcaatcct gtcagaataa acccaatcag ctgatgcttc tgtaccatag aaaatattta
       61 ataacagtga attttgaata aaaggtgtgg tttacctaac tgaacgctgt agcttgcaac
      121 atgaatttcc ttcgacaaac gctcaacgtt acgaaacaat ggacaacaca agctgtacac
      181 aattcctttg tacaaatgcg agaaatggca tcgctgtatc aaatgcaccg cactggaccc
      241 catgtaaaaa aacgcccccc gcgtcagcca ttggatggta agccttttgc caaaggtgtc
      301 gtcctcaaaa cgctcatcaa gaaacccaaa aagcccaact ctgccaatcg taaatgcgta
      361 ctggtgcgtt tgtcaacggg caaggaaatg gtggcctata ttcccggcat cggtcataac
      421 ttgcaggagc acaacatcgt tttgtgccgt gtggggcgcg tacaagatgt tcccggtgtt
      481 aagttgaaat gtgtgcgtgg tgtttatgat ttaaatcatg tcgttaaaaa taaataaaag
      541 caataataaa tttgtaatta tcatttga