Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247773 448 bp mRNA linear INV 02-SEP-2023 (LOC106084224), mRNA. ACCESSION XM_013247773 VERSION XM_013247773.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247773.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..448 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..448 /gene="LOC106084224" /note="uncharacterized LOC106084224; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106084224" CDS 87..416 /gene="LOC106084224" /codon_start=1 /product="uncharacterized protein LOC106084224" /protein_id="XP_013103227.1" /db_xref="GeneID:106084224" /translation="MSLFQMKWLRRLVRQNTKPIPEVEALKWKRRLSLMYALVAWNAF GFVCYMAFTGKGDWAHYYGYKSDEEKHESQALQFSKRLNVEKGKIIRYSGFKKVEELE FDNTKEK" polyA_site 448 /gene="LOC106084224" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcagctgctt gtttgtttat atttattcgg gtcggcgagc gactttatat aattatcagc 61 tttaataaat tacaaaataa cagacaatgt cattgtttca aatgaaatgg cttcgtcggt 121 tggtgagaca aaatactaaa cccattccgg aagtggaagc cctaaaatgg aagcgacgtc 181 tgagtttgat gtatgctctt gtagcttgga atgcgttcgg tttcgtatgc tacatggcct 241 ttactggtaa aggcgattgg gcgcactact atggatacaa atctgatgag gaaaaacatg 301 aatcccaagc cctacaattt agcaagcgtc taaatgttga aaaaggaaaa attataaggt 361 attccggatt taagaaggta gaggagctgg aatttgataa tactaaagaa aagtgaacct 421 ttgaacaatg aaaattatag caatcttc