Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084224


LOCUS       XM_013247773             448 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084224), mRNA.
ACCESSION   XM_013247773
VERSION     XM_013247773.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247773.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..448
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..448
                     /gene="LOC106084224"
                     /note="uncharacterized LOC106084224; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106084224"
     CDS             87..416
                     /gene="LOC106084224"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084224"
                     /protein_id="XP_013103227.1"
                     /db_xref="GeneID:106084224"
                     /translation="MSLFQMKWLRRLVRQNTKPIPEVEALKWKRRLSLMYALVAWNAF
                     GFVCYMAFTGKGDWAHYYGYKSDEEKHESQALQFSKRLNVEKGKIIRYSGFKKVEELE
                     FDNTKEK"
     polyA_site      448
                     /gene="LOC106084224"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcagctgctt gtttgtttat atttattcgg gtcggcgagc gactttatat aattatcagc
       61 tttaataaat tacaaaataa cagacaatgt cattgtttca aatgaaatgg cttcgtcggt
      121 tggtgagaca aaatactaaa cccattccgg aagtggaagc cctaaaatgg aagcgacgtc
      181 tgagtttgat gtatgctctt gtagcttgga atgcgttcgg tttcgtatgc tacatggcct
      241 ttactggtaa aggcgattgg gcgcactact atggatacaa atctgatgag gaaaaacatg
      301 aatcccaagc cctacaattt agcaagcgtc taaatgttga aaaaggaaaa attataaggt
      361 attccggatt taagaaggta gaggagctgg aatttgataa tactaaagaa aagtgaacct
      421 ttgaacaatg aaaattatag caatcttc