Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247767 592 bp mRNA linear INV 02-SEP-2023 transcript variant X1, mRNA. ACCESSION XM_013247767 VERSION XM_013247767.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247767.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..592 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..592 /gene="LOC106084219" /note="cytochrome b5 type B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084219" CDS 77..424 /gene="LOC106084219" /codon_start=1 /product="cytochrome b5 isoform X1" /protein_id="XP_013103221.1" /db_xref="GeneID:106084219" /translation="MVNEIPLETVKQHNKPTDLWVVIENKVYDVTKFRSEHPGGEESL DEVAGRDGTKEFMEVGHSQEAREIMKKFYIGDLAAKDCKGKLPLREITLCLISFAIGA AAIFFIKKTLARN" misc_feature 95..310 /gene="LOC106084219" /note="Cytochrome b5-like Heme/Steroid binding domain; Region: Cyt-b5; pfam00173" /db_xref="CDD:459698" polyA_site 592 /gene="LOC106084219" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tattttctaa tgtacatcta acatttcctt tggaattttc atttgcaatt tgtccaggaa 61 agccacgtga acaaaaatgg tgaacgagat acctcttgaa acggtgaagc agcacaataa 121 gccaacagat ttgtgggttg taatagagaa caaagtctac gatgtaacaa agttccgtag 181 tgagcatcca ggaggcgaag agtccttgga cgaagtggca ggtagagacg gtaccaagga 241 gtttatggag gtcggtcata gccaggaagc cagggagata atgaaaaaat tttatattgg 301 agatctggct gcgaaagact gtaaaggaaa gcttccgtta agggaaatca ccttatgcct 361 tatatcgttc gccattggtg cagcagcaat atttttcatt aaaaagactt tagcaaggaa 421 ctaggaaacg agctacccac agctgtcatt ccagggtaaa actgtgcaat ttgtgttcgt 481 gctaaagatc atcgtcggtt gataattata taacacataa ataacaaagt aattgtaata 541 aatattaaag tataaataaa ctaaagtaaa tattggtgga aatgaaagta aa