Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome b5 type B (LOC106084219),


LOCUS       XM_013247767             592 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X1, mRNA.
ACCESSION   XM_013247767
VERSION     XM_013247767.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247767.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..592
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..592
                     /gene="LOC106084219"
                     /note="cytochrome b5 type B; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084219"
     CDS             77..424
                     /gene="LOC106084219"
                     /codon_start=1
                     /product="cytochrome b5 isoform X1"
                     /protein_id="XP_013103221.1"
                     /db_xref="GeneID:106084219"
                     /translation="MVNEIPLETVKQHNKPTDLWVVIENKVYDVTKFRSEHPGGEESL
                     DEVAGRDGTKEFMEVGHSQEAREIMKKFYIGDLAAKDCKGKLPLREITLCLISFAIGA
                     AAIFFIKKTLARN"
     misc_feature    95..310
                     /gene="LOC106084219"
                     /note="Cytochrome b5-like Heme/Steroid binding domain;
                     Region: Cyt-b5; pfam00173"
                     /db_xref="CDD:459698"
     polyA_site      592
                     /gene="LOC106084219"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tattttctaa tgtacatcta acatttcctt tggaattttc atttgcaatt tgtccaggaa
       61 agccacgtga acaaaaatgg tgaacgagat acctcttgaa acggtgaagc agcacaataa
      121 gccaacagat ttgtgggttg taatagagaa caaagtctac gatgtaacaa agttccgtag
      181 tgagcatcca ggaggcgaag agtccttgga cgaagtggca ggtagagacg gtaccaagga
      241 gtttatggag gtcggtcata gccaggaagc cagggagata atgaaaaaat tttatattgg
      301 agatctggct gcgaaagact gtaaaggaaa gcttccgtta agggaaatca ccttatgcct
      361 tatatcgttc gccattggtg cagcagcaat atttttcatt aaaaagactt tagcaaggaa
      421 ctaggaaacg agctacccac agctgtcatt ccagggtaaa actgtgcaat ttgtgttcgt
      481 gctaaagatc atcgtcggtt gataattata taacacataa ataacaaagt aattgtaata
      541 aatattaaag tataaataaa ctaaagtaaa tattggtgga aatgaaagta aa