Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans inositol oxygenase (LOC106084216),


LOCUS       XM_013247760            1260 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013247760
VERSION     XM_013247760.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247760.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1260
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1260
                     /gene="LOC106084216"
                     /note="inositol oxygenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106084216"
     CDS             99..1139
                     /gene="LOC106084216"
                     /codon_start=1
                     /product="inositol oxygenase"
                     /protein_id="XP_013103214.1"
                     /db_xref="GeneID:106084216"
                     /translation="MVRIKSSVSVNNEHFKERDRTTNYYYAKSGLDGLFVNKTNFTFT
                     KSNKKQNIRKMRILQEHQLDFIDPSELLRPEPTFADKQLSKFRDYSIDENDPLKERVR
                     QTYRLMHQNQTVDFVRSRHERWLKFNTLKATVRQALEKLNDLIDESDPDIDLPNIVHA
                     FQAAERAREEYPELDWLHLTALIHDLGKIMAFYDEPQWCVVGDTYPVGCAWGESIVYR
                     KDSFEGNPDGENPLYNSKYGIYKPNCGVDNLMMSWGHDEYMYQVLKHNRTKLPDIACK
                     IIRFHSFYPWHNGGDYEHLTRPGDDETKKWVLIFNRYDLYTKSEKIPDIDALWPYYQT
                     LIDKYLPGELDF"
     misc_feature    390..1136
                     /gene="LOC106084216"
                     /note="Myo-inositol oxygenase; Region: MIOX; cl46428"
                     /db_xref="CDD:480768"
     polyA_site      1260
                     /gene="LOC106084216"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagcccaatt ataaaaaaga tttttgcgcg ctctcactca aaatgctggc gatatcacac
       61 tagtattgct gccttctctt tcggcgccat ctctcttaat ggtacgtata aaaagcagtg
      121 tttccgtcaa taatgaacat ttcaaggaac gcgatagaac cacgaactac tactacgcta
      181 agagcggact ggacgggctg tttgtcaaca aaacaaattt tacattcaca aaaagcaaca
      241 aaaaacaaaa cataagaaaa atgcgcatat tacaagagca tcaactggat tttatcgatc
      301 cttcggagtt gctgcgacct gaaccgacat ttgccgataa acagttgtca aagtttcgcg
      361 actacagcat tgacgagaat gacccgctta aagaacgggt gcggcaaacc tatcgtctga
      421 tgcaccaaaa ccaaacagtg gattttgtca gaagtcgtca tgagcgctgg cttaaattca
      481 acacactgaa agccactgtc cgccaagcat tggaaaaact caacgacctt attgatgaat
      541 cagatccaga catagactta cctaatatag tgcacgcttt ccaggcagcc gaacgggcaa
      601 gagaagagta tccggaattg gattggttgc atttaaccgc cctgatccat gacttgggca
      661 aaataatggc attctacgat gaaccgcaat ggtgtgtcgt cggagataca tatcccgttg
      721 gatgtgcttg gggcgagagt attgtttatc gaaaggatag tttcgagggc aatcccgatg
      781 gagagaatcc cttgtataat tccaaatatg ggatatacaa acccaattgc ggtgttgata
      841 atctgatgat gtcctggggc cacgacgaat atatgtatca agtactcaag cataatagaa
      901 caaagttgcc agacattgct tgcaaaatca tacgtttcca ttcattttat ccttggcaca
      961 atggcggtga ctatgaacac ttgactagac caggagatga cgagactaaa aaatgggtgc
     1021 tgattttcaa tcgctatgat ttatatacca agagtgagaa aattcctgac attgacgcat
     1081 tatggccgta ctatcaaaca ctaatagaca aatatttgcc aggcgaattg gatttctaac
     1141 cccgcccccg ctttctgctt atttatattt aaaatgttta actgtgatta attgaacaga
     1201 aatatacaca caacttgtac tttttctcat aaaaaaaaaa aaacaaaatc aaaacgccta