Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247760 1260 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013247760 VERSION XM_013247760.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247760.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1260 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1260 /gene="LOC106084216" /note="inositol oxygenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106084216" CDS 99..1139 /gene="LOC106084216" /codon_start=1 /product="inositol oxygenase" /protein_id="XP_013103214.1" /db_xref="GeneID:106084216" /translation="MVRIKSSVSVNNEHFKERDRTTNYYYAKSGLDGLFVNKTNFTFT KSNKKQNIRKMRILQEHQLDFIDPSELLRPEPTFADKQLSKFRDYSIDENDPLKERVR QTYRLMHQNQTVDFVRSRHERWLKFNTLKATVRQALEKLNDLIDESDPDIDLPNIVHA FQAAERAREEYPELDWLHLTALIHDLGKIMAFYDEPQWCVVGDTYPVGCAWGESIVYR KDSFEGNPDGENPLYNSKYGIYKPNCGVDNLMMSWGHDEYMYQVLKHNRTKLPDIACK IIRFHSFYPWHNGGDYEHLTRPGDDETKKWVLIFNRYDLYTKSEKIPDIDALWPYYQT LIDKYLPGELDF" misc_feature 390..1136 /gene="LOC106084216" /note="Myo-inositol oxygenase; Region: MIOX; cl46428" /db_xref="CDD:480768" polyA_site 1260 /gene="LOC106084216" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tagcccaatt ataaaaaaga tttttgcgcg ctctcactca aaatgctggc gatatcacac 61 tagtattgct gccttctctt tcggcgccat ctctcttaat ggtacgtata aaaagcagtg 121 tttccgtcaa taatgaacat ttcaaggaac gcgatagaac cacgaactac tactacgcta 181 agagcggact ggacgggctg tttgtcaaca aaacaaattt tacattcaca aaaagcaaca 241 aaaaacaaaa cataagaaaa atgcgcatat tacaagagca tcaactggat tttatcgatc 301 cttcggagtt gctgcgacct gaaccgacat ttgccgataa acagttgtca aagtttcgcg 361 actacagcat tgacgagaat gacccgctta aagaacgggt gcggcaaacc tatcgtctga 421 tgcaccaaaa ccaaacagtg gattttgtca gaagtcgtca tgagcgctgg cttaaattca 481 acacactgaa agccactgtc cgccaagcat tggaaaaact caacgacctt attgatgaat 541 cagatccaga catagactta cctaatatag tgcacgcttt ccaggcagcc gaacgggcaa 601 gagaagagta tccggaattg gattggttgc atttaaccgc cctgatccat gacttgggca 661 aaataatggc attctacgat gaaccgcaat ggtgtgtcgt cggagataca tatcccgttg 721 gatgtgcttg gggcgagagt attgtttatc gaaaggatag tttcgagggc aatcccgatg 781 gagagaatcc cttgtataat tccaaatatg ggatatacaa acccaattgc ggtgttgata 841 atctgatgat gtcctggggc cacgacgaat atatgtatca agtactcaag cataatagaa 901 caaagttgcc agacattgct tgcaaaatca tacgtttcca ttcattttat ccttggcaca 961 atggcggtga ctatgaacac ttgactagac caggagatga cgagactaaa aaatgggtgc 1021 tgattttcaa tcgctatgat ttatatacca agagtgagaa aattcctgac attgacgcat 1081 tatggccgta ctatcaaaca ctaatagaca aatatttgcc aggcgaattg gatttctaac 1141 cccgcccccg ctttctgctt atttatattt aaaatgttta actgtgatta attgaacaga 1201 aatatacaca caacttgtac tttttctcat aaaaaaaaaa aaacaaaatc aaaacgccta