Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084199


LOCUS       XM_013247738             891 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084199), mRNA.
ACCESSION   XM_013247738
VERSION     XM_013247738.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247738.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..891
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..891
                     /gene="LOC106084199"
                     /note="uncharacterized LOC106084199; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106084199"
     CDS             298..624
                     /gene="LOC106084199"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084199"
                     /protein_id="XP_013103192.1"
                     /db_xref="GeneID:106084199"
                     /translation="MESSYQDISELEKSVAHAGSQLNCMAHKLHEVERRCLDCNQEID
                     DTCVLELLESMSEVRNEYINLRKDIQEVQQLQRDVTTSIRFQMRTMHQTYQVLKKRLE
                     LKSSRK"
     misc_feature    331..612
                     /gene="LOC106084199"
                     /note="Spindle and kinetochore-associated protein 2;
                     Region: SKA2; cl17165"
                     /db_xref="CDD:473067"
     polyA_site      891
                     /gene="LOC106084199"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gccaaactgt ataaaaggaa atgcccgtag agctacacaa gcagttctaa aagtgaatta
       61 gacaggagcc aagagagagc atagcaaaaa aaaaaaaaac aaaatacaaa caaacaaaat
      121 ctccttaaaa tagtgtaaaa tttgaaaata tatagattaa aaaaaacact aacacacata
      181 catacgcaga cgaaaaagtt aattgtaaga aagggcacca atttcttata gtggttagtg
      241 gggagtatat gcttccagtt tcatgctaaa tacatttaat tgaacattaa cctaattatg
      301 gaatcgtcat atcaagatat aagtgaattg gaaaaatctg tggcccatgc tggctcacaa
      361 ttgaattgta tggcacacaa gcttcatgaa gtggagcgcc gttgtttgga ctgtaaccaa
      421 gaaatcgacg atacatgtgt cttggagttg ctggagtcga tgtctgaggt acgcaacgag
      481 tacattaatt tacgcaagga catacaggaa gtgcaacagt tacagcgtga cgtcactaca
      541 tccatacgat ttcaaatgcg caccatgcat caaacgtacc aagtgttaaa aaagcgcttg
      601 gaattaaaat cgtcgagaaa atagaattcc taacgctcac acaattggca atcaaaatgc
      661 atttcagttc atctctatgt aggggcaaat gtataaaaag aaaaatagct ggcaatagga
      721 gtgaaattga actaagtttt tttatgtttc gactataaac cttcattaaa attttattta
      781 ctgctcaacc ggttgaaagt gatcagtagc aacaataagc gtagattttt caaaaagaaa
      841 attacgttta agcgcttaat ctcacagaaa taaaacaaat atcatcctgt t