Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans gamma-aminobutyric acid


LOCUS       XM_013247737             738 bp    mRNA    linear   INV 02-SEP-2023
            receptor-associated protein (LOC106084198), mRNA.
ACCESSION   XM_013247737
VERSION     XM_013247737.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247737.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..738
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..738
                     /gene="LOC106084198"
                     /note="gamma-aminobutyric acid receptor-associated
                     protein; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 ESTs, 39 Proteins"
                     /db_xref="GeneID:106084198"
     CDS             155..514
                     /gene="LOC106084198"
                     /codon_start=1
                     /product="gamma-aminobutyric acid receptor-associated
                     protein"
                     /protein_id="XP_013103191.1"
                     /db_xref="GeneID:106084198"
                     /translation="MKFQYKEEHVFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDL
                     DKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPPTSATMGSLYQEHHEED
                     YFLYIAYSDENVYGNRR"
     misc_feature    158..502
                     /gene="LOC106084198"
                     /note="first ubiquitin-like (Ubl) domain located at the
                     N-terminus of coronavirus SARS-CoV non-structural protein
                     3 (Nsp3) and related proteins; Region:
                     Ubl1_cv_Nsp3_N-like; cl28922"
                     /db_xref="CDD:475130"
     polyA_site      738
                     /gene="LOC106084198"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcaacatat tcccattcgt cgagaacaac caattccaat tcatagtaca aaaaataata
       61 aaacaacgca gtagatacaa taaagaagtc attgaaacaa gtcaaattga ttaaatctta
      121 aattgaattt tatagtagaa gaagcatata caaaatgaag ttccaatata aagaagagca
      181 cgtattcgag aaacgtcgtg ccgaaggcga taaaattcgc agaaaatacc ctgaccgcgt
      241 acccgtgatc gttgaaaagg cacccaaagc acgcattgga gatttggaca aaaagaaata
      301 tttagtgcca tccgatttaa cagtgggaca gttttacttc ttgatccgta aacgtataca
      361 attgcgacct gaggatgccc tattcttttt cgtcaacaat gtaattccac ccacatctgc
      421 caccatgggt tccctctacc aggaacatca tgaggaggac tatttccttt acattgcata
      481 ttccgatgaa aatgtttatg gcaacagacg ttagattaag catttagacc attgctctgg
      541 agtgtgatta aacaaagaaa aaactgaaga aacttacgaa aaacaagaga attttgggca
      601 cgtatatgaa aaattacaac aaaaacacgt ttaatttgtt tatttgtctg taacccatat
      661 gaaaaatgca aacaaaaata tacttcagcc acaagagata tgtgcaaaac aaaaatattg
      721 atcttacaaa taactaaa