Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247737 738 bp mRNA linear INV 02-SEP-2023 receptor-associated protein (LOC106084198), mRNA. ACCESSION XM_013247737 VERSION XM_013247737.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247737.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..738 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..738 /gene="LOC106084198" /note="gamma-aminobutyric acid receptor-associated protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 ESTs, 39 Proteins" /db_xref="GeneID:106084198" CDS 155..514 /gene="LOC106084198" /codon_start=1 /product="gamma-aminobutyric acid receptor-associated protein" /protein_id="XP_013103191.1" /db_xref="GeneID:106084198" /translation="MKFQYKEEHVFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDL DKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPPTSATMGSLYQEHHEED YFLYIAYSDENVYGNRR" misc_feature 158..502 /gene="LOC106084198" /note="first ubiquitin-like (Ubl) domain located at the N-terminus of coronavirus SARS-CoV non-structural protein 3 (Nsp3) and related proteins; Region: Ubl1_cv_Nsp3_N-like; cl28922" /db_xref="CDD:475130" polyA_site 738 /gene="LOC106084198" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcaacatat tcccattcgt cgagaacaac caattccaat tcatagtaca aaaaataata 61 aaacaacgca gtagatacaa taaagaagtc attgaaacaa gtcaaattga ttaaatctta 121 aattgaattt tatagtagaa gaagcatata caaaatgaag ttccaatata aagaagagca 181 cgtattcgag aaacgtcgtg ccgaaggcga taaaattcgc agaaaatacc ctgaccgcgt 241 acccgtgatc gttgaaaagg cacccaaagc acgcattgga gatttggaca aaaagaaata 301 tttagtgcca tccgatttaa cagtgggaca gttttacttc ttgatccgta aacgtataca 361 attgcgacct gaggatgccc tattcttttt cgtcaacaat gtaattccac ccacatctgc 421 caccatgggt tccctctacc aggaacatca tgaggaggac tatttccttt acattgcata 481 ttccgatgaa aatgtttatg gcaacagacg ttagattaag catttagacc attgctctgg 541 agtgtgatta aacaaagaaa aaactgaaga aacttacgaa aaacaagaga attttgggca 601 cgtatatgaa aaattacaac aaaaacacgt ttaatttgtt tatttgtctg taacccatat 661 gaaaaatgca aacaaaaata tacttcagcc acaagagata tgtgcaaaac aaaaatattg 721 atcttacaaa taactaaa