PREDICTED: Stomoxys calcitrans protein canopy homolog 4

LOCUS       XM_013247735             790 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084197), mRNA.
ACCESSION   XM_013247735
VERSION     XM_013247735.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247735.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..790
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..790
                     /gene="LOC106084197"
                     /note="protein canopy homolog 4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106084197"
     CDS             87..743
                     /gene="LOC106084197"
                     /codon_start=1
                     /product="protein canopy homolog 4"
                     /protein_id="XP_013103189.1"
                     /db_xref="GeneID:106084197"
                     /translation="MVLKMLQVCVTFLLLISQHTFAGTPEEEQGVRYANKCETCKILA
                     TELQERLSETGKSHDVIETGYSVDDVKPKKRKEYRRSELRLLESIENVCDRILEYNLH
                     KERSDSTRFAKGMSETFKTLHGLVDKGVKVDLGIPLELWDKPPVEVTQMKSQCENMLE
                     TYEDAIYEWYFHKQDEKNLIDHLCAEQVLAVDDRKCLKESLKISDKKNKKSKGDKEDL
                     "
     misc_feature    192..644
                     /gene="LOC106084197"
                     /note="TLR4 regulator and MIR-interacting MSAP; Region:
                     DUF3456; pfam11938"
                     /db_xref="CDD:463404"
     polyA_site      790
                     /gene="LOC106084197"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacaacatca tgccccaaaa catgacgttg ttttttccat agtctgcaac actaccggca
       61 aaagttaaat tgtgttgaat ttttcgatgg ttttaaagat gctacaagtt tgtgtcacct
      121 ttcttttgct gatatcacaa cacactttcg ctggcacacc cgaagaagag cagggagtgc
      181 gctatgcaaa caaatgcgag acctgtaaaa ttctggccac cgaactgcag gagcggcttt
      241 ccgagactgg caagtctcac gatgttatcg agactggcta ttcagtggac gatgtgaaac
      301 ctaaaaaacg caaagaatac cgtcgaagtg agctgcgttt attggaatcc atagagaatg
      361 tgtgcgatcg aattttggag tacaatttgc ataaggaacg tagtgatagc acacgatttg
      421 ccaaaggcat gtcagagact ttcaagacat tgcatggact agtagacaaa ggcgtgaaag
      481 tagatttggg tattccatta gagttatggg acaagccacc agtggaggta acacaaatga
      541 agagtcaatg tgaaaatatg cttgaaacct atgaagacgc catatacgag tggtatttcc
      601 ataagcagga tgaaaagaat ctaattgacc atttgtgtgc cgaacaagtc ttagctgtgg
      661 acgataggaa atgccttaag gaatctctca aaataagcga taagaagaat aaaaagtcga
      721 aaggcgataa agaggactta tgaacatgca tgtagaacaa gcaaataaat catgtgattc
      781 ctgatcttta