Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247731 445 bp mRNA linear INV 02-SEP-2023 (LOC106084192), mRNA. ACCESSION XM_013247731 VERSION XM_013247731.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247731.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..445 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..445 /gene="LOC106084192" /note="uncharacterized LOC106084192; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106084192" CDS 99..395 /gene="LOC106084192" /codon_start=1 /product="uncharacterized protein LOC106084192" /protein_id="XP_013103185.1" /db_xref="GeneID:106084192" /translation="MPALRRDIGPFLQRMRAFLLGREHTLALRFEDGLADRTQPPPEI PYPVLRSDCYYHGRDPRRIVAPPVDLVQANLKIASDSKPAANRLPTPGQVYKWD" misc_feature 123..386 /gene="LOC106084192" /note="NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a); Region: CI-B14_5a; pfam07347" /db_xref="CDD:462149" polyA_site 445 /gene="LOC106084192" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agctggtagg ttaaacgaag ttgatatttg cattagattc tatcaatttt tttatttttt 61 gctttgcaaa cttcgtatag tattgtcgtt tattagcaat gcctgcctta cgtcgtgata 121 ttggtccatt tttgcaacgt atgagagcct ttttattggg ccgtgagcat acattggctt 181 tgcgttttga agatggtcta gcagatcgta cccagccacc tccagagata ccatatcccg 241 ttttgaggtc tgactgttac tatcacggac gcgatcctcg tcgcattgtg gctcctcccg 301 tcgatttggt tcaagccaat ttaaaaattg ccagcgattc caagccagct gcaaatcgtt 361 tgcccacccc aggacaagtg tacaaatggg attaaactaa ttaaacatta ataaatcggc 421 gtgatgttag ttaattgaaa tcaaa