Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084192


LOCUS       XM_013247731             445 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084192), mRNA.
ACCESSION   XM_013247731
VERSION     XM_013247731.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247731.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..445
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..445
                     /gene="LOC106084192"
                     /note="uncharacterized LOC106084192; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:106084192"
     CDS             99..395
                     /gene="LOC106084192"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084192"
                     /protein_id="XP_013103185.1"
                     /db_xref="GeneID:106084192"
                     /translation="MPALRRDIGPFLQRMRAFLLGREHTLALRFEDGLADRTQPPPEI
                     PYPVLRSDCYYHGRDPRRIVAPPVDLVQANLKIASDSKPAANRLPTPGQVYKWD"
     misc_feature    123..386
                     /gene="LOC106084192"
                     /note="NADH:ubiquinone oxidoreductase subunit B14.5a
                     (Complex I-B14.5a); Region: CI-B14_5a; pfam07347"
                     /db_xref="CDD:462149"
     polyA_site      445
                     /gene="LOC106084192"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agctggtagg ttaaacgaag ttgatatttg cattagattc tatcaatttt tttatttttt
       61 gctttgcaaa cttcgtatag tattgtcgtt tattagcaat gcctgcctta cgtcgtgata
      121 ttggtccatt tttgcaacgt atgagagcct ttttattggg ccgtgagcat acattggctt
      181 tgcgttttga agatggtcta gcagatcgta cccagccacc tccagagata ccatatcccg
      241 ttttgaggtc tgactgttac tatcacggac gcgatcctcg tcgcattgtg gctcctcccg
      301 tcgatttggt tcaagccaat ttaaaaattg ccagcgattc caagccagct gcaaatcgtt
      361 tgcccacccc aggacaagtg tacaaatggg attaaactaa ttaaacatta ataaatcggc
      421 gtgatgttag ttaattgaaa tcaaa