Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mediator of RNA polymerase II


LOCUS       XM_013247730             553 bp    mRNA    linear   INV 02-SEP-2023
            transcription subunit 22 (LOC106084191), mRNA.
ACCESSION   XM_013247730
VERSION     XM_013247730.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247730.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..553
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..553
                     /gene="LOC106084191"
                     /note="mediator of RNA polymerase II transcription subunit
                     22; Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:106084191"
     CDS             92..514
                     /gene="LOC106084191"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 22"
                     /protein_id="XP_013103184.1"
                     /db_xref="GeneID:106084191"
                     /translation="MNPNRALPQSKEALLKSYQVRLKDDVKSMLENFEEIIKLARGEG
                     DSQISKTTQCEQDTYEMQVRAANIVRAGESLMKLVSDIKQYLILNDFHSVNEAIANNS
                     QLFRATQRDCDKKLMKLRDEMAMDLYDLEEEYYTSIFK"
     misc_feature    152..454
                     /gene="LOC106084191"
                     /note="Surfeit locus protein 5 subunit 22 of Mediator
                     complex; Region: Med22; pfam06179"
                     /db_xref="CDD:461845"
     polyA_site      553
                     /gene="LOC106084191"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttatcgatt actttcagct ggtcagccaa cagtttttgt ttactcctcc acaaaaagga
       61 aacaaattga agtagaatct aaaacaaaaa tatgaatcct aatcgtgcgt tgccccaatc
      121 taaggaagct ttattgaagt cgtatcaagt cagacttaaa gatgacgtaa aaagtatgct
      181 tgagaatttt gaagaaataa ttaaacttgc tcgaggcgag ggagattccc aaatctcaaa
      241 aacaacacaa tgtgaacaag acacatatga aatgcaagtg cgtgcagcga atatagtacg
      301 tgctggtgaa tcgttaatga aattagtttc cgatataaaa caatatctaa tcttaaacga
      361 ttttcattcc gtgaatgagg ctattgccaa caactcacaa ctgttccgtg ctactcaaag
      421 agactgcgat aaaaagctga tgaaacttcg cgatgaaatg gcaatggatt tgtatgatct
      481 ggaagaagaa tattacacaa gtatattcaa atagagctat gaagaatttt taaataaatt
      541 attttaaaac aaa