Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247730 553 bp mRNA linear INV 02-SEP-2023 transcription subunit 22 (LOC106084191), mRNA. ACCESSION XM_013247730 VERSION XM_013247730.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247730.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..553 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..553 /gene="LOC106084191" /note="mediator of RNA polymerase II transcription subunit 22; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106084191" CDS 92..514 /gene="LOC106084191" /codon_start=1 /product="mediator of RNA polymerase II transcription subunit 22" /protein_id="XP_013103184.1" /db_xref="GeneID:106084191" /translation="MNPNRALPQSKEALLKSYQVRLKDDVKSMLENFEEIIKLARGEG DSQISKTTQCEQDTYEMQVRAANIVRAGESLMKLVSDIKQYLILNDFHSVNEAIANNS QLFRATQRDCDKKLMKLRDEMAMDLYDLEEEYYTSIFK" misc_feature 152..454 /gene="LOC106084191" /note="Surfeit locus protein 5 subunit 22 of Mediator complex; Region: Med22; pfam06179" /db_xref="CDD:461845" polyA_site 553 /gene="LOC106084191" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttatcgatt actttcagct ggtcagccaa cagtttttgt ttactcctcc acaaaaagga 61 aacaaattga agtagaatct aaaacaaaaa tatgaatcct aatcgtgcgt tgccccaatc 121 taaggaagct ttattgaagt cgtatcaagt cagacttaaa gatgacgtaa aaagtatgct 181 tgagaatttt gaagaaataa ttaaacttgc tcgaggcgag ggagattccc aaatctcaaa 241 aacaacacaa tgtgaacaag acacatatga aatgcaagtg cgtgcagcga atatagtacg 301 tgctggtgaa tcgttaatga aattagtttc cgatataaaa caatatctaa tcttaaacga 361 ttttcattcc gtgaatgagg ctattgccaa caactcacaa ctgttccgtg ctactcaaag 421 agactgcgat aaaaagctga tgaaacttcg cgatgaaatg gcaatggatt tgtatgatct 481 ggaagaagaa tattacacaa gtatattcaa atagagctat gaagaatttt taaataaatt 541 attttaaaac aaa