PREDICTED: Stomoxys calcitrans ADP-ribosylation factor 4

LOCUS       XM_013247729             783 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084190), mRNA.
ACCESSION   XM_013247729
VERSION     XM_013247729.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247729.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..783
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..783
                     /gene="LOC106084190"
                     /note="ADP-ribosylation factor 4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 203
                     Proteins"
                     /db_xref="GeneID:106084190"
     CDS             121..663
                     /gene="LOC106084190"
                     /codon_start=1
                     /product="ADP-ribosylation factor 4"
                     /protein_id="XP_013103183.1"
                     /db_xref="GeneID:106084190"
                     /translation="MGLLISNLLNNFLSKQNVRILMVGLDGAGKTTILYKLKIGEVIS
                     TIPTIGFNVETVEYKNICFTVWDIGGQKKIRNLWNHYFPNTSAVIFVVDSSDTQRMDD
                     VKEELHGMMSNEVLASSVLLVFANKQDLPNALSCADLTKQLELHTLKQDWHVHATCAT
                     TGKGLYEGLDYLRDMLEKKN"
     misc_feature    121..660
                     /gene="LOC106084190"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    190..213
                     /gene="LOC106084190"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(196..216,328..330,496..501,505..507,592..600)
                     /gene="LOC106084190"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    262..264
                     /gene="LOC106084190"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    274..282
                     /gene="LOC106084190"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    319..330
                     /gene="LOC106084190"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(325..330,376..381)
                     /gene="LOC106084190"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    496..507
                     /gene="LOC106084190"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    592..600
                     /gene="LOC106084190"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     polyA_site      783
                     /gene="LOC106084190"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccattcttgt caacttacca cgtcagaatc agaactgtca tacatttctt cacaataaag
       61 aaaataattt gctaaaaaag tcaaagtttt caatataaac gcattcattt ctattgcaag
      121 atgggtttac ttatctcaaa cctgctcaac aatttcctaa gcaaacaaaa tgttcgtata
      181 ctgatggttg gcttggatgg tgctggtaaa actaccattc tatacaaact caaaataggt
      241 gaagttatct cgaccattcc aacgattggc ttcaatgtcg agactgtgga atataaaaac
      301 atctgcttca ccgtctggga tattggtggt caaaagaaaa ttagaaacct gtggaatcac
      361 tacttcccaa atacgtctgc cgtcatattt gttgtcgatt catcagatac acaacgcatg
      421 gatgatgtga aagaagaact acacggcatg atgtccaatg aggttttggc aagctcggta
      481 ttattagtgt ttgcaaacaa gcaagacttg ccaaatgccc taagttgtgc ggacttgaca
      541 aaacaattgg aattgcatac cctaaagcaa gactggcatg tccatgccac atgtgccaca
      601 accggcaaag gtctctacga gggtttggac tacttgcgtg atatgttgga gaagaaaaat
      661 taaacctttc tcttaatgcg tattcagtga atggacattc taatatacat acatacatat
      721 tttaagttaa ttttaattgt aaacgaagat tataataata aataagcccc tgtataatcc
      781 ata