Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans C-type lectin 37Db-like


LOCUS       XM_013247709             628 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084180), mRNA.
ACCESSION   XM_013247709
VERSION     XM_013247709.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247709.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..628
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..628
                     /gene="LOC106084180"
                     /note="C-type lectin 37Db-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084180"
     CDS             35..571
                     /gene="LOC106084180"
                     /codon_start=1
                     /product="C-type lectin 37Db-like"
                     /protein_id="XP_013103163.1"
                     /db_xref="GeneID:106084180"
                     /translation="MAVNFLHIFIILAIWSNVLDARTTKTSTSMQGYPDDLDISGFTK
                     VGKKRYHFGQSKVSWFRANLICRSMGGYLASFENDDELSQVSSYLRNTYPTDRIWWTS
                     GSDLQGEGDFFCYNTGERMKYANWIPGQPDNASGNEHCINLIFKEYKIQMNTADCDEV
                     GYYVCEADKPVNVLLTVV"
     misc_feature    176..532
                     /gene="LOC106084180"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(446..448,461..463,467..469,485..487,491..502,
                     509..517)
                     /gene="LOC106084180"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 ccaaacagtc ttctggtagt aactacaagg caaaatggca gtaaactttt tacatatatt
       61 tattattttg gccatttgga gcaatgtact tgacgcacga actaccaaaa cttcgacttc
      121 tatgcaaggc tatcccgatg atttggatat atcaggcttt actaaagttg gcaagaaacg
      181 ctaccacttt ggacaaagca aagtatcgtg gtttagggca aatttgatat gtcgctcaat
      241 gggtggttat ttagcatcct ttgaaaacga cgacgaatta agccaagtat cgagttattt
      301 gagaaacacc tatcccacag ataggatatg gtggacctct ggttccgacc tgcaaggtga
      361 aggagacttc ttttgctaca acaccggcga acgcatgaaa tatgctaact ggatacctgg
      421 tcaaccggac aatgctagtg gaaatgaaca ttgtattaat ttaattttta aagaatacaa
      481 aattcaaatg aacactgcgg attgcgatga ggttggctat tacgtgtgtg aggcagataa
      541 gcctgttaat gtgttgttaa ccgttgttta aataaatacg aaaagtgagt tgatttcaaa
      601 aaaaaaatta aattacataa aataataa