Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247709 628 bp mRNA linear INV 02-SEP-2023 (LOC106084180), mRNA. ACCESSION XM_013247709 VERSION XM_013247709.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247709.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..628 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..628 /gene="LOC106084180" /note="C-type lectin 37Db-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106084180" CDS 35..571 /gene="LOC106084180" /codon_start=1 /product="C-type lectin 37Db-like" /protein_id="XP_013103163.1" /db_xref="GeneID:106084180" /translation="MAVNFLHIFIILAIWSNVLDARTTKTSTSMQGYPDDLDISGFTK VGKKRYHFGQSKVSWFRANLICRSMGGYLASFENDDELSQVSSYLRNTYPTDRIWWTS GSDLQGEGDFFCYNTGERMKYANWIPGQPDNASGNEHCINLIFKEYKIQMNTADCDEV GYYVCEADKPVNVLLTVV" misc_feature 176..532 /gene="LOC106084180" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(446..448,461..463,467..469,485..487,491..502, 509..517) /gene="LOC106084180" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" ORIGIN 1 ccaaacagtc ttctggtagt aactacaagg caaaatggca gtaaactttt tacatatatt 61 tattattttg gccatttgga gcaatgtact tgacgcacga actaccaaaa cttcgacttc 121 tatgcaaggc tatcccgatg atttggatat atcaggcttt actaaagttg gcaagaaacg 181 ctaccacttt ggacaaagca aagtatcgtg gtttagggca aatttgatat gtcgctcaat 241 gggtggttat ttagcatcct ttgaaaacga cgacgaatta agccaagtat cgagttattt 301 gagaaacacc tatcccacag ataggatatg gtggacctct ggttccgacc tgcaaggtga 361 aggagacttc ttttgctaca acaccggcga acgcatgaaa tatgctaact ggatacctgg 421 tcaaccggac aatgctagtg gaaatgaaca ttgtattaat ttaattttta aagaatacaa 481 aattcaaatg aacactgcgg attgcgatga ggttggctat tacgtgtgtg aggcagataa 541 gcctgttaat gtgttgttaa ccgttgttta aataaatacg aaaagtgagt tgatttcaaa 601 aaaaaaatta aattacataa aataataa