Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans C-type lectin 37Db (LOC106084179),


LOCUS       XM_013247708            1059 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013247708
VERSION     XM_013247708.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247708.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1059
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1059
                     /gene="LOC106084179"
                     /note="C-type lectin 37Db; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 21
                     Proteins"
                     /db_xref="GeneID:106084179"
     CDS             297..836
                     /gene="LOC106084179"
                     /codon_start=1
                     /product="C-type lectin 37Db"
                     /protein_id="XP_013103162.1"
                     /db_xref="GeneID:106084179"
                     /translation="MTLNFLKIFITLSFGCVIHGARTPKISTNTMEGYGHGLDTSPFV
                     EVGNKLYHFGQNKASWFRASLICRSLGGNLASIDNSNELRLISEHLRTTCRTDRSYWI
                     SGSNLQGGGGFFCYNTGERMTFADWAPGKPKNATGKDHCVNLMFTNNKFQMNDEDCNQ
                     SDYYICEAEQPTNVMVSVF"
     misc_feature    447..797
                     /gene="LOC106084179"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(711..713,726..728,732..734,750..752,756..767,
                     774..782)
                     /gene="LOC106084179"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 ataatgtcga atgtattttt taaaagggcc caaaaggggg ataactctgg ggcagcgtta
       61 aattgttttc ttctaattct catcaagaac atacctcaat tttcagaaaa aaaaaatata
      121 tctatatatg tatttgatgt gttttgacat aagctggata aatattaaac aaacaggaac
      181 aattaagaaa ttcgcccata taaagacacg ctatggttgg gtctgcattc atttaaaacc
      241 gcgctctaat agaaaacatt ctttaaagag tcttcttgtc tggcacaaaa agcaaaatga
      301 cattgaattt cttaaaaatc ttcattacct taagctttgg ctgcgttata catggcgcac
      361 gaactcccaa aatatcaacc aatacaatgg aaggatatgg tcatggtttg gatacatcac
      421 cctttgttga ggtgggcaac aaactctacc actttggaca aaacaaagcg tcatggttta
      481 gggcaagttt gatatgtcgt tctttgggtg gcaatttggc atctattgat aatagcaacg
      541 aattacggct catatcggaa cacttaagaa ccacttgccg caccgatagg tcgtattgga
      601 tctcaggctc caacctgcaa ggcggaggcg gcttcttttg ctataacacc ggcgaacgca
      661 tgacctttgc tgactgggca cccggaaaac caaagaatgc tactggaaaa gatcattgtg
      721 tgaatttaat gttcacaaat aacaaatttc aaatgaacga cgaggattgc aatcaatctg
      781 attactacat atgtgaggct gaacagccca ctaatgtgat ggtatccgtt ttttaaaatg
      841 tccattgcat ttgaaaagaa ggaaagttag ttgatttaaa tgaaagtact ttgtttttgt
      901 ctttaaaatt tttttattac atttttaata aatagcagca aaaaacaaac aaaatattta
      961 gatttatttg aacatcgtgg tgcataggaa gcactactgc tgttgaacta tttgtgtcca
     1021 tttcagtcct gttcaacttt tttacttaaa cttggcaaa