Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247708 1059 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013247708 VERSION XM_013247708.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247708.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1059 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1059 /gene="LOC106084179" /note="C-type lectin 37Db; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 21 Proteins" /db_xref="GeneID:106084179" CDS 297..836 /gene="LOC106084179" /codon_start=1 /product="C-type lectin 37Db" /protein_id="XP_013103162.1" /db_xref="GeneID:106084179" /translation="MTLNFLKIFITLSFGCVIHGARTPKISTNTMEGYGHGLDTSPFV EVGNKLYHFGQNKASWFRASLICRSLGGNLASIDNSNELRLISEHLRTTCRTDRSYWI SGSNLQGGGGFFCYNTGERMTFADWAPGKPKNATGKDHCVNLMFTNNKFQMNDEDCNQ SDYYICEAEQPTNVMVSVF" misc_feature 447..797 /gene="LOC106084179" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(711..713,726..728,732..734,750..752,756..767, 774..782) /gene="LOC106084179" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" ORIGIN 1 ataatgtcga atgtattttt taaaagggcc caaaaggggg ataactctgg ggcagcgtta 61 aattgttttc ttctaattct catcaagaac atacctcaat tttcagaaaa aaaaaatata 121 tctatatatg tatttgatgt gttttgacat aagctggata aatattaaac aaacaggaac 181 aattaagaaa ttcgcccata taaagacacg ctatggttgg gtctgcattc atttaaaacc 241 gcgctctaat agaaaacatt ctttaaagag tcttcttgtc tggcacaaaa agcaaaatga 301 cattgaattt cttaaaaatc ttcattacct taagctttgg ctgcgttata catggcgcac 361 gaactcccaa aatatcaacc aatacaatgg aaggatatgg tcatggtttg gatacatcac 421 cctttgttga ggtgggcaac aaactctacc actttggaca aaacaaagcg tcatggttta 481 gggcaagttt gatatgtcgt tctttgggtg gcaatttggc atctattgat aatagcaacg 541 aattacggct catatcggaa cacttaagaa ccacttgccg caccgatagg tcgtattgga 601 tctcaggctc caacctgcaa ggcggaggcg gcttcttttg ctataacacc ggcgaacgca 661 tgacctttgc tgactgggca cccggaaaac caaagaatgc tactggaaaa gatcattgtg 721 tgaatttaat gttcacaaat aacaaatttc aaatgaacga cgaggattgc aatcaatctg 781 attactacat atgtgaggct gaacagccca ctaatgtgat ggtatccgtt ttttaaaatg 841 tccattgcat ttgaaaagaa ggaaagttag ttgatttaaa tgaaagtact ttgtttttgt 901 ctttaaaatt tttttattac atttttaata aatagcagca aaaaacaaac aaaatattta 961 gatttatttg aacatcgtgg tgcataggaa gcactactgc tgttgaacta tttgtgtcca 1021 tttcagtcct gttcaacttt tttacttaaa cttggcaaa