Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247707 996 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013247707 VERSION XM_013247707.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247707.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..996 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..996 /gene="LOC106084178" /note="C-type lectin 37Db; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 24 Proteins" /db_xref="GeneID:106084178" CDS 190..738 /gene="LOC106084178" /codon_start=1 /product="C-type lectin 37Db" /protein_id="XP_013103161.1" /db_xref="GeneID:106084178" /translation="MLINILNASIFILLGCGSIVLGVQRGPRISTTVLEGYPDELNVS PFTKVGKKLYNFGQSKVSWFQANLICRSMGGYLASIENQNEMSELSDYLKANYPTDRW WWLSGSDLQGEGDFYWYRTGERLTYTDWSIGQPDNAGGSENCVHLWYKDPKFQMNDWI CSQAAFYICEADKPTTVVVSVF" misc_feature 349..699 /gene="LOC106084178" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(613..615,625..627,631..633,652..654,658..669, 676..684) /gene="LOC106084178" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" polyA_site 996 /gene="LOC106084178" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aatctcagtc tgccacggga gaaagcaacc aagccagcag ataaagacga aaaccactaa 61 aaaatccccg aattgttatt gccagtcggg ttgaatgtct cattgattgg cgatcatctt 121 taatgcttaa atgatgttgc tgatcattta atctttcagc aaccttaaag agagtaactt 181 cagcggaaaa tgttaataaa tattttaaat gccagtatat tcatattatt gggctgcgga 241 agcattgtcc ttggggtcca aaggggtccc agaatctcaa caactgtttt ggaaggctat 301 ccggatgagc tgaatgtgtc accttttact aaagttggca aaaaactcta caattttgga 361 caaagcaaag tatcgtggtt tcaagcaaat ttaatttgcc gttcaatggg tggttatttg 421 gcgtcaattg agaatcagaa cgaaatgtcc gagttatccg attatttgaa agccaattat 481 cctacagaca gatggtggtg gctctctggc tccgatttgc agggcgaggg cgatttctat 541 tggtatagaa ctggtgaacg tctaacgtat actgattggt caatcggcca gccggataat 601 gctggtggta gtgaaaattg tgttcatttg tggtataagg acccaaagtt tcagatgaac 661 gattggattt gcagtcaggc tgccttctac atttgtgaag ctgataagcc taccacagta 721 gttgtgtcag tattttaatc taagcattgc aagcagaaaa ttgataacaa aaaattgaaa 781 aagtgagaaa taaacgaatc aggtaattgc atcaaaacta aacacataac aaataacttg 841 aacattgaat attgagtagc ttcaaaaatt ctctataaaa atcaaattct gagaatacag 901 aaattaaaca tcccaaagaa atcaattgtt gggagaaaac gctttagaaa taagatttta 961 acaacttttt gaataaatat ataaattttg aacgaa