Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans C-type lectin 37Db (LOC106084178),


LOCUS       XM_013247707             996 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013247707
VERSION     XM_013247707.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247707.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..996
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..996
                     /gene="LOC106084178"
                     /note="C-type lectin 37Db; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 24
                     Proteins"
                     /db_xref="GeneID:106084178"
     CDS             190..738
                     /gene="LOC106084178"
                     /codon_start=1
                     /product="C-type lectin 37Db"
                     /protein_id="XP_013103161.1"
                     /db_xref="GeneID:106084178"
                     /translation="MLINILNASIFILLGCGSIVLGVQRGPRISTTVLEGYPDELNVS
                     PFTKVGKKLYNFGQSKVSWFQANLICRSMGGYLASIENQNEMSELSDYLKANYPTDRW
                     WWLSGSDLQGEGDFYWYRTGERLTYTDWSIGQPDNAGGSENCVHLWYKDPKFQMNDWI
                     CSQAAFYICEADKPTTVVVSVF"
     misc_feature    349..699
                     /gene="LOC106084178"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(613..615,625..627,631..633,652..654,658..669,
                     676..684)
                     /gene="LOC106084178"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     polyA_site      996
                     /gene="LOC106084178"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aatctcagtc tgccacggga gaaagcaacc aagccagcag ataaagacga aaaccactaa
       61 aaaatccccg aattgttatt gccagtcggg ttgaatgtct cattgattgg cgatcatctt
      121 taatgcttaa atgatgttgc tgatcattta atctttcagc aaccttaaag agagtaactt
      181 cagcggaaaa tgttaataaa tattttaaat gccagtatat tcatattatt gggctgcgga
      241 agcattgtcc ttggggtcca aaggggtccc agaatctcaa caactgtttt ggaaggctat
      301 ccggatgagc tgaatgtgtc accttttact aaagttggca aaaaactcta caattttgga
      361 caaagcaaag tatcgtggtt tcaagcaaat ttaatttgcc gttcaatggg tggttatttg
      421 gcgtcaattg agaatcagaa cgaaatgtcc gagttatccg attatttgaa agccaattat
      481 cctacagaca gatggtggtg gctctctggc tccgatttgc agggcgaggg cgatttctat
      541 tggtatagaa ctggtgaacg tctaacgtat actgattggt caatcggcca gccggataat
      601 gctggtggta gtgaaaattg tgttcatttg tggtataagg acccaaagtt tcagatgaac
      661 gattggattt gcagtcaggc tgccttctac atttgtgaag ctgataagcc taccacagta
      721 gttgtgtcag tattttaatc taagcattgc aagcagaaaa ttgataacaa aaaattgaaa
      781 aagtgagaaa taaacgaatc aggtaattgc atcaaaacta aacacataac aaataacttg
      841 aacattgaat attgagtagc ttcaaaaatt ctctataaaa atcaaattct gagaatacag
      901 aaattaaaca tcccaaagaa atcaattgtt gggagaaaac gctttagaaa taagatttta
      961 acaacttttt gaataaatat ataaattttg aacgaa