Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans 28 kDa heat- and acid-stable


LOCUS       XM_013247687             862 bp    mRNA    linear   INV 02-SEP-2023
            phosphoprotein (LOC106084173), mRNA.
ACCESSION   XM_013247687
VERSION     XM_013247687.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247687.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..862
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..862
                     /gene="LOC106084173"
                     /note="28 kDa heat- and acid-stable phosphoprotein;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 6 Proteins"
                     /db_xref="GeneID:106084173"
     CDS             176..724
                     /gene="LOC106084173"
                     /codon_start=1
                     /product="28 kDa heat- and acid-stable phosphoprotein"
                     /protein_id="XP_013103141.1"
                     /db_xref="GeneID:106084173"
                     /translation="MPRGKYVNHKGRSRHFTSPEEMQQQSEDESSSEESGEEEEQAGS
                     SKGNAKKGAAPPGTLPPSDSEEEDESSEDDRDAKKGVAGLIEIENPNRAVKKVAQKVE
                     KLNVSGGDSAKPELTRREREQIEKQKARLRYEKLHADGKTAQAKSDLARLALIRQQRA
                     DAAAKREAEKKLAEDKKGTTKS"
     misc_feature    440..688
                     /gene="LOC106084173"
                     /note="Casein kinase substrate phosphoprotein PP28;
                     Region: PP28; pfam10252"
                     /db_xref="CDD:463025"
     polyA_site      862
                     /gene="LOC106084173"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttttaacaa tcgatactcg atattaggac ttttgattaa tcgcctggtt cgctcgcaca
       61 cacactcaat aatcactttc gcactctcga attcacgtat ctaaattcta attacaattt
      121 cgcattaaga agttgaaaag ttgattaaat ttagatatat tgttaataca taatcatgcc
      181 acgtggaaaa tatgttaacc ataaaggccg atcgcgtcat tttacatctc cggaagaaat
      241 gcaacagcaa agtgaggatg aaagtagtag cgaggaatca ggtgaagaag aagaacaagc
      301 aggaagcagt aagggcaacg caaagaaggg cgctgcgcca cctggtacac ttccaccatc
      361 agactctgaa gaagaggacg agtcgtcaga agatgaccgt gacgctaaga agggtgttgc
      421 tggtctaatc gaaattgaaa acccaaacag agctgttaag aaggttgcac aaaaagttga
      481 aaaattaaat gtaagtggcg gcgatagtgc aaaaccagaa ctaacgcgac gtgagcgaga
      541 acaaatagaa aaacagaagg cgcgtttacg gtatgaaaag ctacacgcag acggcaagac
      601 ggcacaggct aagtccgatc tggcccgttt ggctttaata cggcaacaac gagctgacgc
      661 tgctgcaaaa cgagaagcag aaaagaaact ggctgaggat aagaagggaa ctacaaaatc
      721 atagatgatc tgtagatata acttcaacat ttcttcggca tattttgata tccattgttt
      781 tcatttcttc agaaactcaa gcaattgcaa tgtttttata tattaaaata taatacatgt
      841 ataaataatt ttacagaatg ca