Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247687 862 bp mRNA linear INV 02-SEP-2023 phosphoprotein (LOC106084173), mRNA. ACCESSION XM_013247687 VERSION XM_013247687.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247687.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..862 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..862 /gene="LOC106084173" /note="28 kDa heat- and acid-stable phosphoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106084173" CDS 176..724 /gene="LOC106084173" /codon_start=1 /product="28 kDa heat- and acid-stable phosphoprotein" /protein_id="XP_013103141.1" /db_xref="GeneID:106084173" /translation="MPRGKYVNHKGRSRHFTSPEEMQQQSEDESSSEESGEEEEQAGS SKGNAKKGAAPPGTLPPSDSEEEDESSEDDRDAKKGVAGLIEIENPNRAVKKVAQKVE KLNVSGGDSAKPELTRREREQIEKQKARLRYEKLHADGKTAQAKSDLARLALIRQQRA DAAAKREAEKKLAEDKKGTTKS" misc_feature 440..688 /gene="LOC106084173" /note="Casein kinase substrate phosphoprotein PP28; Region: PP28; pfam10252" /db_xref="CDD:463025" polyA_site 862 /gene="LOC106084173" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gttttaacaa tcgatactcg atattaggac ttttgattaa tcgcctggtt cgctcgcaca 61 cacactcaat aatcactttc gcactctcga attcacgtat ctaaattcta attacaattt 121 cgcattaaga agttgaaaag ttgattaaat ttagatatat tgttaataca taatcatgcc 181 acgtggaaaa tatgttaacc ataaaggccg atcgcgtcat tttacatctc cggaagaaat 241 gcaacagcaa agtgaggatg aaagtagtag cgaggaatca ggtgaagaag aagaacaagc 301 aggaagcagt aagggcaacg caaagaaggg cgctgcgcca cctggtacac ttccaccatc 361 agactctgaa gaagaggacg agtcgtcaga agatgaccgt gacgctaaga agggtgttgc 421 tggtctaatc gaaattgaaa acccaaacag agctgttaag aaggttgcac aaaaagttga 481 aaaattaaat gtaagtggcg gcgatagtgc aaaaccagaa ctaacgcgac gtgagcgaga 541 acaaatagaa aaacagaagg cgcgtttacg gtatgaaaag ctacacgcag acggcaagac 601 ggcacaggct aagtccgatc tggcccgttt ggctttaata cggcaacaac gagctgacgc 661 tgctgcaaaa cgagaagcag aaaagaaact ggctgaggat aagaagggaa ctacaaaatc 721 atagatgatc tgtagatata acttcaacat ttcttcggca tattttgata tccattgttt 781 tcatttcttc agaaactcaa gcaattgcaa tgtttttata tattaaaata taatacatgt 841 ataaataatt ttacagaatg ca