PREDICTED: Stomoxys calcitrans 27 kDa hemolymph protein

LOCUS       XM_013247682             908 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084169), mRNA.
ACCESSION   XM_013247682
VERSION     XM_013247682.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247682.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..908
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..908
                     /gene="LOC106084169"
                     /note="27 kDa hemolymph protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106084169"
     CDS             12..908
                     /gene="LOC106084169"
                     /codon_start=1
                     /product="27 kDa hemolymph protein"
                     /protein_id="XP_013103136.2"
                     /db_xref="GeneID:106084169"
                     /translation="MAKVCTILVLLTSCALIQNASAQNALELESELQGYLPSNRGQSK
                     FSLQAAKDLLERKCSKVLLNSTASTQFEKFERAGHKFFECVSNIANATEVLEEVEAAR
                     PTGDLDLVIVKYCQRIPQAKKCLNEFNEQLLVCLTPSERIENANMMRIFTSLLDALCH
                     KNGDSIALFIAEEGPECLEANKDNIVECMNATFAAYLPDEVPAELPELVIGSKQCIEL
                     HDFEQCVLNYLEKCKEVTPSGIVESVFRYLRRETICQVEIEKVTSKHQRNGAMLAPKL
                     AWPMFAILAAILASQSSVKFLL"
ORIGIN      
        1 cttccaattc catggccaag gtgtgtacga ttctcgttct tctcacctca tgtgctctga
       61 ttcagaacgc aagtgcccaa aatgcgctcg agttagaaag tgaacttcaa ggttatttac
      121 cttcgaatcg gggccaatct aaattttccc tgcaagctgc caaagatctg ctggagagga
      181 agtgcagcaa agttctgcta aatagcacag cttcaacaca attcgagaag ttcgaaaggg
      241 ctggccacaa gttcttcgag tgtgtcagca acattgccaa tgctacagag gtattggaag
      301 aagtggaagc tgcacgcccc acaggagatc tggatttggt tattgtgaag tactgccaaa
      361 gaattcccca agcgaagaag tgtctaaacg aattcaatga gcaactcttg gtatgtttga
      421 ctccaagcga gaggattgaa aatgccaata tgatgcgtat tttcacatcg ctgctggatg
      481 ccctctgcca taaaaacggc gattcgatag cccttttcat agcggaggaa ggtcccgagt
      541 gtttagaggc caacaaggat aacattgtgg agtgcatgaa tgccacattc gccgcatacc
      601 tgcccgacga ggtgcctgca gagttgccag aactggtcat aggctccaag cagtgcattg
      661 agctgcatga ctttgagcaa tgtgtactga actatttgga aaagtgtaaa gaggtaactc
      721 catcgggcat tgtggagtcc gtctttagat acttgcgcag agaaaccata tgtcaagttg
      781 aaattgaaaa ggtgacatcc aaacatcaac gcaatggggc gatgcttgcc cccaagttgg
      841 catggccaat gttcgcaata ctggcggcaa tattggcctc acaatcaagt gtcaagtttt
      901 tactgtaa