Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247681 711 bp mRNA linear INV 02-SEP-2023 (LOC106084167), mRNA. ACCESSION XM_013247681 VERSION XM_013247681.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247681.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..711 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..711 /gene="LOC106084167" /note="cytochrome P450 4d2-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106084167" CDS 85..711 /gene="LOC106084167" /codon_start=1 /product="cytochrome P450 4d2-like" /protein_id="XP_013103135.2" /db_xref="GeneID:106084167" /translation="MWWLIFSFIFSSLIIWDVLKRQRHNLVLKQSSIKGPYFIEPLIG DSWLGLGNDRANVFRLFAKLKNKYGRVYRLWLFYDLMLVISDVKYFETILTCTNTIKK SFIYDMFTKWLGEGLLLSHGSKWYARRKLLTPTYHFKILEDFVEVFDQQSRVLVKRLH PMADGKTVYNIFPVICPTALDIITETAMGVKVNAQDHPDFPYVEAVKK" ORIGIN 1 tttgttaaat actcgatggg aagacagtat caaaacggct ttcaaaacga caatcttcaa 61 tgaattttta aacgcattct gaaaatgtgg tggcttatct tcagttttat attttcaagt 121 ctcatcatct gggatgtttt aaagaggcaa cggcataatc ttgttctcaa acaatcctct 181 atcaaagggc catattttat tgagcccctc atcggagatt catggctggg attgggcaat 241 gatagagcaa atgtttttcg tctttttgcc aagctcaaaa ataaatacgg aagagtttat 301 cgcttgtggc tattttatga tttaatgttg gtcatttcgg atgtgaaata tttcgaaaca 361 attctaacct gtacaaatac cattaagaaa tcattcatct acgatatgtt taccaagtgg 421 ttgggtgagg gcctattgct aagtcatggc tcgaaatggt acgctagacg aaaacttctc 481 acgcccacct atcatttcaa gatactggag gattttgtgg aggtattcga tcaacagagt 541 cgagtattgg taaaacgcct ccatccaatg gccgatggca agacggttta taatattttc 601 ccagttatat gccccaccgc attggacatc attacggaaa cggccatggg agtaaaggtg 661 aatgctcagg atcatccgga ctttccctac gtcgaagcag taaaaaagta a