Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome P450 4d2-like


LOCUS       XM_013247681             711 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084167), mRNA.
ACCESSION   XM_013247681
VERSION     XM_013247681.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247681.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..711
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..711
                     /gene="LOC106084167"
                     /note="cytochrome P450 4d2-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:106084167"
     CDS             85..711
                     /gene="LOC106084167"
                     /codon_start=1
                     /product="cytochrome P450 4d2-like"
                     /protein_id="XP_013103135.2"
                     /db_xref="GeneID:106084167"
                     /translation="MWWLIFSFIFSSLIIWDVLKRQRHNLVLKQSSIKGPYFIEPLIG
                     DSWLGLGNDRANVFRLFAKLKNKYGRVYRLWLFYDLMLVISDVKYFETILTCTNTIKK
                     SFIYDMFTKWLGEGLLLSHGSKWYARRKLLTPTYHFKILEDFVEVFDQQSRVLVKRLH
                     PMADGKTVYNIFPVICPTALDIITETAMGVKVNAQDHPDFPYVEAVKK"
ORIGIN      
        1 tttgttaaat actcgatggg aagacagtat caaaacggct ttcaaaacga caatcttcaa
       61 tgaattttta aacgcattct gaaaatgtgg tggcttatct tcagttttat attttcaagt
      121 ctcatcatct gggatgtttt aaagaggcaa cggcataatc ttgttctcaa acaatcctct
      181 atcaaagggc catattttat tgagcccctc atcggagatt catggctggg attgggcaat
      241 gatagagcaa atgtttttcg tctttttgcc aagctcaaaa ataaatacgg aagagtttat
      301 cgcttgtggc tattttatga tttaatgttg gtcatttcgg atgtgaaata tttcgaaaca
      361 attctaacct gtacaaatac cattaagaaa tcattcatct acgatatgtt taccaagtgg
      421 ttgggtgagg gcctattgct aagtcatggc tcgaaatggt acgctagacg aaaacttctc
      481 acgcccacct atcatttcaa gatactggag gattttgtgg aggtattcga tcaacagagt
      541 cgagtattgg taaaacgcct ccatccaatg gccgatggca agacggttta taatattttc
      601 ccagttatat gccccaccgc attggacatc attacggaaa cggccatggg agtaaaggtg
      661 aatgctcagg atcatccgga ctttccctac gtcgaagcag taaaaaagta a