Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein Vago (LOC106084153), mRNA.


LOCUS       XM_013247657             804 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013247657
VERSION     XM_013247657.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247657.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..804
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..804
                     /gene="LOC106084153"
                     /note="protein Vago; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 Proteins"
                     /db_xref="GeneID:106084153"
     CDS             228..794
                     /gene="LOC106084153"
                     /codon_start=1
                     /product="protein Vago"
                     /protein_id="XP_013103111.2"
                     /db_xref="GeneID:106084153"
                     /translation="MYLLMLSLLLLLLLSNVINLTFATPSTYARDRFLANSRCVDSET
                     GRELYVGDSFTRSGRCINVQCLDTLQLWEDRCQVPQLEGNCTKIPVANEFLDYPRCCP
                     TYECTSYKTDDNSITYETRTFDRYGRLLTERIMQRVRVLVHHPQSQYPGNGNQDWKCD
                     ENGRDCTRTVYPIGNAASRDNVLQIKYT"
     polyA_site      804
                     /gene="LOC106084153"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtacatacga cgtcttaatc ttgactggag cgcgtttcag tttcaagtgg ccaaacacct
       61 cgacaaaatt tcaaaaacat ttcagttgac aatcaacgat taggaagaga caaagcttaa
      121 taacaaactg ggaagaggaa aacattctaa taacattgaa ataaatattt cttaataatt
      181 tcataaaggt taaacaataa aaaaattgag taatccctag tccaaaaatg tatctactta
      241 tgctgtcgtt gctgctgctg ctgctactat caaatgttat caacttgaca ttcgccactc
      301 cttccaccta tgcccgcgat cgcttccttg caaattcaag atgtgttgat agtgaaactg
      361 gtcgtgaact ttatgtggga gattcattta cccgatcggg ccggtgcatc aatgtgcaat
      421 gtttggacac acttcagttg tgggaggaca gatgtcaagt tccccaactg gaaggtaact
      481 gtacaaaaat accagttgct aatgaatttt tagattatcc acgctgctgc cccacctatg
      541 aatgtaccag ctataagact gatgataata gcattacata tgaaactcgt acctttgatc
      601 gttacggtcg cttactaacg gaacgtatca tgcaaagagt aagagttttg gtgcatcatc
      661 cacaatccca atatccaggc aacggtaatc aggattggaa atgtgatgaa aatggtagag
      721 attgtacaag aactgtatat ccgattggca atgcggcgag tagggataat gttttacaaa
      781 tcaaatatac ttaatttaat tcaa