Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans NPC intracellular cholesterol


LOCUS       XM_013247656             751 bp    mRNA    linear   INV 02-SEP-2023
            transporter 2 homolog a (LOC106084152), mRNA.
ACCESSION   XM_013247656
VERSION     XM_013247656.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247656.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..751
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..751
                     /gene="LOC106084152"
                     /note="NPC intracellular cholesterol transporter 2 homolog
                     a; Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 27 Proteins"
                     /db_xref="GeneID:106084152"
     CDS             222..674
                     /gene="LOC106084152"
                     /codon_start=1
                     /product="NPC intracellular cholesterol transporter 2
                     homolog a"
                     /protein_id="XP_013103110.2"
                     /db_xref="GeneID:106084152"
                     /translation="MKQFVILSIVAVFFLYSVDALQFTDCGSKIGKFTKVLVSDCDTT
                     KNECILKRNSTVSITIDFSLAEDVTSIKTVVHGKVMGVEMPFHLQNPDACVDSGLKCP
                     LEKGETYEYLASLPVLKAYPKVNVMVKWELQDQSGEDIVCVEIPAKIQ"
     polyA_site      751
                     /gene="LOC106084152"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gattcaacga cgaccgcctt tgaagagact aaacagcaaa cgattcttca atgattcact
       61 tcgtttcatt taaacataaa caatcggtct gtgctgacac aacgctaaca ggaaaaaagc
      121 agttttgaac attagtgtgc attcattcag tggctagcca ttgtaaaata cggttggaga
      181 aaatattttc aagaagaaaa aaaaacatca gcattaaaaa aatgaaacaa tttgtgattt
      241 tgtctattgt ggctgtattt ttcctttatt ctgtggatgc tttacaattc acagattgtg
      301 gttccaaaat tggcaaattt acaaaagtac ttgtatctga ctgtgacaca accaaaaatg
      361 agtgtatatt gaaaagaaat tctacagtat ccattaccat tgatttctcc ttggctgaag
      421 atgtcacctc aataaagact gtggtccatg gcaaagtgat gggtgttgag atgcctttcc
      481 atttgcagaa tccagatgcg tgtgttgaca gtggtttaaa atgtcccttg gaaaaggggg
      541 aaacatatga atacctggcc agcttacctg ttctaaaagc ttatcccaaa gtcaatgtta
      601 tggtcaaatg ggaattacaa gatcaatccg gtgaagacat tgtctgcgta gaaattccag
      661 ccaaaattca atagattcat gacaattaaa aaaaaaactg caaattttta gaacttcaaa
      721 taaataattt aagttttgta atatgataaa a