Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247656 751 bp mRNA linear INV 02-SEP-2023 transporter 2 homolog a (LOC106084152), mRNA. ACCESSION XM_013247656 VERSION XM_013247656.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247656.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..751 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..751 /gene="LOC106084152" /note="NPC intracellular cholesterol transporter 2 homolog a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 27 Proteins" /db_xref="GeneID:106084152" CDS 222..674 /gene="LOC106084152" /codon_start=1 /product="NPC intracellular cholesterol transporter 2 homolog a" /protein_id="XP_013103110.2" /db_xref="GeneID:106084152" /translation="MKQFVILSIVAVFFLYSVDALQFTDCGSKIGKFTKVLVSDCDTT KNECILKRNSTVSITIDFSLAEDVTSIKTVVHGKVMGVEMPFHLQNPDACVDSGLKCP LEKGETYEYLASLPVLKAYPKVNVMVKWELQDQSGEDIVCVEIPAKIQ" polyA_site 751 /gene="LOC106084152" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gattcaacga cgaccgcctt tgaagagact aaacagcaaa cgattcttca atgattcact 61 tcgtttcatt taaacataaa caatcggtct gtgctgacac aacgctaaca ggaaaaaagc 121 agttttgaac attagtgtgc attcattcag tggctagcca ttgtaaaata cggttggaga 181 aaatattttc aagaagaaaa aaaaacatca gcattaaaaa aatgaaacaa tttgtgattt 241 tgtctattgt ggctgtattt ttcctttatt ctgtggatgc tttacaattc acagattgtg 301 gttccaaaat tggcaaattt acaaaagtac ttgtatctga ctgtgacaca accaaaaatg 361 agtgtatatt gaaaagaaat tctacagtat ccattaccat tgatttctcc ttggctgaag 421 atgtcacctc aataaagact gtggtccatg gcaaagtgat gggtgttgag atgcctttcc 481 atttgcagaa tccagatgcg tgtgttgaca gtggtttaaa atgtcccttg gaaaaggggg 541 aaacatatga atacctggcc agcttacctg ttctaaaagc ttatcccaaa gtcaatgtta 601 tggtcaaatg ggaattacaa gatcaatccg gtgaagacat tgtctgcgta gaaattccag 661 ccaaaattca atagattcat gacaattaaa aaaaaaactg caaattttta gaacttcaaa 721 taaataattt aagttttgta atatgataaa a