Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans histone-lysine N-methyltransferase


LOCUS       XM_013247647             724 bp    mRNA    linear   INV 02-SEP-2023
            set1 (LOC106084143), mRNA.
ACCESSION   XM_013247647
VERSION     XM_013247647.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247647.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..724
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..724
                     /gene="LOC106084143"
                     /note="histone-lysine N-methyltransferase set1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106084143"
     CDS             248..640
                     /gene="LOC106084143"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase set1"
                     /protein_id="XP_013103101.1"
                     /db_xref="GeneID:106084143"
                     /translation="MASGLIDKRKRSREDDVSCDSDTPLSKRINNLHLSNFEEVPQYN
                     PHLPTNNNSHHHHHSNNHHLPHHLAKELMHHQQHSTSVMKTVVIGNEEHDESMYNPEL
                     NESENPFYYIKNKLLHDLHLERLKRCTV"
     polyA_site      724
                     /gene="LOC106084143"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttggccagct atcaagtcta atatccaata tcagtcccat acaaaaaagc tactgttgtg
       61 agtagtatta tttacattca caatagatac gaaaacttgc cgattaaacg tcctacattg
      121 gttaatgcta gttgttgaac tggcaaccct gttataaaaa caaaacaatg acagcttgaa
      181 aaaaaaaaat agaaaaaaga aaataaattc gttgtgaaac tagcttgaaa aaaggaaatg
      241 cttaaatatg gcatcgggac taattgataa aagaaaacgc agccgagaag atgatgtctc
      301 atgtgattca gatactccct tgtctaaacg aataaacaat ttgcatttat caaattttga
      361 agaggttcct caatacaacc ctcatctgcc aactaataac aatagccatc atcaccacca
      421 cagcaacaac catcatctac cacaccattt ggccaaagag ctgatgcacc accaacagca
      481 ttcaacatct gttatgaaaa cagtcgtcat aggcaatgag gagcatgatg agagcatgta
      541 caatcccgaa ctaaatgagt cggaaaatcc attctactat atcaaaaata aactattgca
      601 cgatctacat ttggaacgcc ttaagagatg tacagtttaa agttattgtc caatctgcta
      661 tcaatttttt ataattatac gtttagaaaa gctcctggaa tagagtatta tgtttaattt
      721 gata