Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cdc42 homolog (LOC106084141), mRNA.


LOCUS       XM_013247645            1553 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013247645
VERSION     XM_013247645.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247645.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1553
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1553
                     /gene="LOC106084141"
                     /note="cdc42 homolog; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 56 Proteins"
                     /db_xref="GeneID:106084141"
     CDS             123..698
                     /gene="LOC106084141"
                     /codon_start=1
                     /product="cdc42 homolog"
                     /protein_id="XP_013103099.1"
                     /db_xref="GeneID:106084141"
                     /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTV
                     MIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEIQ
                     HHAQKTPFLLVGTQIDLRDETSTLEKLAKNKQKPIGIEMGEKLAKELKAVKYVECSAL
                     TQKGLKNVFDEAILAALEPPEPAKKKKCRFL"
     misc_feature    129..653
                     /gene="LOC106084141"
                     /note="cell division cycle 42 (Cdc42) is a small GTPase of
                     the Rho family; Region: Cdc42; cd01874"
                     /db_xref="CDD:206664"
     misc_feature    order(129..131,135..137,213..218,225..230,234..239,
                     243..245,249..251,276..278,288..305,312..323,330..335,
                     339..344,429..434)
                     /gene="LOC106084141"
                     /note="GEF (guanine nucleotide exchange factor)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(132..134,141..161,168..170,180..185,189..191,
                     204..206,210..266,276..281,291..311,321..326,330..332,
                     468..470,480..482,618..620,630..632,639..644,651..653)
                     /gene="LOC106084141"
                     /note="ACK tyrosine kinase interaction site [active]"
                     /db_xref="CDD:206664"
     misc_feature    150..173
                     /gene="LOC106084141"
                     /note="G1 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(159..176,207..209,216..221,225..227,291..296,
                     300..302,468..470,474..476,597..602)
                     /gene="LOC106084141"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206664"
     misc_feature    order(180..185,228..230,234..236,240..242,258..260,
                     321..323,330..332,639..644,651..653)
                     /gene="LOC106084141"
                     /note="CRIB effector interaction site [active]"
                     /db_xref="CDD:206664"
     misc_feature    order(189..197,231..233,237..245,249..251,255..263,
                     312..314,618..620)
                     /gene="LOC106084141"
                     /note="Par6 cell polarity protein interaction site
                     [active]"
                     /db_xref="CDD:206664"
     misc_feature    195..242
                     /gene="LOC106084141"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(216..218,222..224,228..233,303..314,321..323,
                     330..332)
                     /gene="LOC106084141"
                     /note="GAP (GTPase-activating protein) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(225..230,297..299,312..314,318..323,327..332,
                     339..341,429..434,438..440)
                     /gene="LOC106084141"
                     /note="GDI (guanine nucleotide dissociation inhibitor)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:206664"
     misc_feature    225..227
                     /gene="LOC106084141"
                     /note="G2 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    291..302
                     /gene="LOC106084141"
                     /note="G3 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    297..353
                     /gene="LOC106084141"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206664"
     misc_feature    465..476
                     /gene="LOC106084141"
                     /note="G4 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    594..602
                     /gene="LOC106084141"
                     /note="G5 box; other site"
                     /db_xref="CDD:206664"
     polyA_site      1553
                     /gene="LOC106084141"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcagcgacg gcgcgccgac gtcgaaaatc aactcgtctt cgtactctgc ttcttacttc
       61 ttattgtgag tgtgaattcg acgatctgcc caacccatat tcaaaaaaac taacgcagaa
      121 caatgcaaac tataaagtgt gttgttgtag gtgatggtgc cgtgggtaag acctgcctgc
      181 ttatctccta cacaaccaat aaattccctt cggaatatgt acccaccgta ttcgacaatt
      241 atgctgtcac tgttatgatt ggtggcgaac catacaccct gggtcttttc gataccgctg
      301 gtcaagagga ttacgatcgt ttacgtccat tgtcatatcc acaaacagat gtattcttgg
      361 tgtgtttctc agtcgttagt cctagttcat ttgaaaatgt aaaagagaaa tgggtgccgg
      421 aaattcaaca ccatgctcaa aagactccct tcctgttggt gggaacgcaa atagatttgc
      481 gtgatgaaac cagtacattg gaaaagttgg ccaagaataa acagaagccc attggcattg
      541 agatgggcga aaagttggct aaagaattaa aagcagtcaa atatgttgag tgttctgctt
      601 taacacagaa aggtcttaaa aatgtattcg atgaagccat cttagctgca ttggagcctc
      661 cagaacccgc caagaaaaag aagtgcagat tcttataatt tctatgtgta ttataattta
      721 ttgaaaataa cacaagatac acgcaatcat aaattctaaa gcataacaac aacaacaaaa
      781 aaacacaact attggattac taacgaaaac agagaaaagt tatttgaaaa gcgtcatttg
      841 atttgattat taaatttgaa aacgaacagc aggaggagat ttaactcgga tgtgtctagc
      901 ttttgtataa ggtaaattgg aaccagcagc agtagtagat aacaacacac aataatcatt
      961 atttgcaatg agaatctttg atagtcctaa aataacagag atttaattaa caccaacatt
     1021 ataatacgta atgttataaa aacaaaaaca aatactattt ttagaaaaca ctaaaaatga
     1081 tcgaacttca taatgaaatc taacaaagaa acaacactac taatggcagt aacaataatt
     1141 tattatctct catgtcatgt catgaaagtg aataacaaaa ccaaaagaat attgaaagaa
     1201 taaaacaaaa cgcaacattt aactgaaaaa aaatatagtt atttgtcatt ggacatgtga
     1261 agcaatcttt cttaaaaaaa aaaaaacaca acaactacac agttttgcta tactacaaca
     1321 acaacaagaa aacataacat ctattgttaa agatacatat taaaaaagaa gtcatttgca
     1381 gcatacatca gtaatatata acacatatac acttatatat acaccgctcc tttttccttc
     1441 cctccactaa cgtttcgttt ttttctttac cataatttaa gtttgcgctt tgaaattgcg
     1501 tgtataagcg ttaaggcaaa gaaccccctc aacacaagta atactttttt ttt