Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084140


LOCUS       XM_013247644             518 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084140), transcript variant X2, mRNA.
ACCESSION   XM_013247644
VERSION     XM_013247644.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247644.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..518
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..518
                     /gene="LOC106084140"
                     /note="uncharacterized LOC106084140; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106084140"
     CDS             86..427
                     /gene="LOC106084140"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084140 isoform X2"
                     /protein_id="XP_013103098.1"
                     /db_xref="GeneID:106084140"
                     /translation="MFQLQNISGALFVLMVLGAEACFTTQYLGNSIHPTLKDHCFHED
                     FNLTIPVEMTIYPTNIEFKCFKVHCRSDFVLEMKHCDRYPNYCTESSSFDYTKPYPDC
                     CPKVECPQNLV"
     misc_feature    221..409
                     /gene="LOC106084140"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      518
                     /gene="LOC106084140"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgggctaaag attttcgatg ttagtatttg ctaagctttg taaacgagcg gtttgacaaa
       61 cggaataact aacgagatta ccaaaatgtt tcaactgcag aatatttcgg gagcactttt
      121 cgttctgatg gtcttaggag ctgaggcttg ttttacaact caataccttg gcaattcaat
      181 acacccaacc ttaaaggatc attgtttcca cgaagacttt aatctaacca tacccgtaga
      241 gatgaccatc tatcccacca atattgaatt caaatgcttc aaagttcatt gccgttcaga
      301 ttttgtattg gaaatgaaac actgtgatcg ttatcccaac tattgcactg agtcttcatc
      361 gtttgattat acaaaaccct atccggattg ttgtcccaaa gtggagtgtc cacaaaattt
      421 agtgtagctt tgaatgtttg tttgatttaa tgtatttaca tgattatttg ttatacaaac
      481 taagaaagtg ttaaagaaat tatatttttt tgttagaa