Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247644 518 bp mRNA linear INV 02-SEP-2023 (LOC106084140), transcript variant X2, mRNA. ACCESSION XM_013247644 VERSION XM_013247644.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247644.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..518 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..518 /gene="LOC106084140" /note="uncharacterized LOC106084140; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106084140" CDS 86..427 /gene="LOC106084140" /codon_start=1 /product="uncharacterized protein LOC106084140 isoform X2" /protein_id="XP_013103098.1" /db_xref="GeneID:106084140" /translation="MFQLQNISGALFVLMVLGAEACFTTQYLGNSIHPTLKDHCFHED FNLTIPVEMTIYPTNIEFKCFKVHCRSDFVLEMKHCDRYPNYCTESSSFDYTKPYPDC CPKVECPQNLV" misc_feature 221..409 /gene="LOC106084140" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 518 /gene="LOC106084140" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgggctaaag attttcgatg ttagtatttg ctaagctttg taaacgagcg gtttgacaaa 61 cggaataact aacgagatta ccaaaatgtt tcaactgcag aatatttcgg gagcactttt 121 cgttctgatg gtcttaggag ctgaggcttg ttttacaact caataccttg gcaattcaat 181 acacccaacc ttaaaggatc attgtttcca cgaagacttt aatctaacca tacccgtaga 241 gatgaccatc tatcccacca atattgaatt caaatgcttc aaagttcatt gccgttcaga 301 ttttgtattg gaaatgaaac actgtgatcg ttatcccaac tattgcactg agtcttcatc 361 gtttgattat acaaaaccct atccggattg ttgtcccaaa gtggagtgtc cacaaaattt 421 agtgtagctt tgaatgtttg tttgatttaa tgtatttaca tgattatttg ttatacaaac 481 taagaaagtg ttaaagaaat tatatttttt tgttagaa