Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084125


LOCUS       XM_013247606             551 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084125), transcript variant X2, mRNA.
ACCESSION   XM_013247606
VERSION     XM_013247606.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247606.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..551
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..551
                     /gene="LOC106084125"
                     /note="uncharacterized LOC106084125; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106084125"
     CDS             183..491
                     /gene="LOC106084125"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084125 isoform X2"
                     /protein_id="XP_013103060.1"
                     /db_xref="GeneID:106084125"
                     /translation="MSSKLFLTLAAFLAFIAIVASQGAFYLGNRRHPTLDGHCYDNDN
                     DLTLKIDETIYPTLPGKCFKLYCRDDYVLQYNYCPRRPLPCTGHPDFSKPFPECCNCD
                     "
     misc_feature    297..479
                     /gene="LOC106084125"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      551
                     /gene="LOC106084125"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taaatcagtg tttattgaat atatatgcaa aacaaacact tgtttcaact tttactacag
       61 gcggtgactc aaaacgaaaa taataatagc agtaattgca agtgaattaa attttttagt
      121 ttcaaaaaaa aaaaaaaaca caatctactt gccaaacaaa gtgggacata tcaggtaaca
      181 ctatgtcctc taaattattc ttaacattgg cagccttttt ggctttcatc gctattgtgg
      241 cctcgcaagg agcattttat ttgggaaatc gcaggcatcc gactttggat ggtcactgct
      301 atgacaatga caatgatttg acattaaaaa tagatgaaac tatctatcct actttaccag
      361 gaaaatgctt taagctgtac tgtcgtgacg attatgtgct acaatacaac tactgtccac
      421 gccgtccttt accttgtaca ggtcatccgg acttttcgaa acctttcccc gaatgctgta
      481 attgtgattg aatgatgtaa gagtaaaaat atataaatta ataaagaagg cataaggtcc
      541 aaatcaactt t