Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247606 551 bp mRNA linear INV 02-SEP-2023 (LOC106084125), transcript variant X2, mRNA. ACCESSION XM_013247606 VERSION XM_013247606.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247606.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..551 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..551 /gene="LOC106084125" /note="uncharacterized LOC106084125; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106084125" CDS 183..491 /gene="LOC106084125" /codon_start=1 /product="uncharacterized protein LOC106084125 isoform X2" /protein_id="XP_013103060.1" /db_xref="GeneID:106084125" /translation="MSSKLFLTLAAFLAFIAIVASQGAFYLGNRRHPTLDGHCYDNDN DLTLKIDETIYPTLPGKCFKLYCRDDYVLQYNYCPRRPLPCTGHPDFSKPFPECCNCD " misc_feature 297..479 /gene="LOC106084125" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 551 /gene="LOC106084125" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taaatcagtg tttattgaat atatatgcaa aacaaacact tgtttcaact tttactacag 61 gcggtgactc aaaacgaaaa taataatagc agtaattgca agtgaattaa attttttagt 121 ttcaaaaaaa aaaaaaaaca caatctactt gccaaacaaa gtgggacata tcaggtaaca 181 ctatgtcctc taaattattc ttaacattgg cagccttttt ggctttcatc gctattgtgg 241 cctcgcaagg agcattttat ttgggaaatc gcaggcatcc gactttggat ggtcactgct 301 atgacaatga caatgatttg acattaaaaa tagatgaaac tatctatcct actttaccag 361 gaaaatgctt taagctgtac tgtcgtgacg attatgtgct acaatacaac tactgtccac 421 gccgtccttt accttgtaca ggtcatccgg acttttcgaa acctttcccc gaatgctgta 481 attgtgattg aatgatgtaa gagtaaaaat atataaatta ataaagaagg cataaggtcc 541 aaatcaactt t