Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084125


LOCUS       XM_013247604             438 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084125), transcript variant X1, mRNA.
ACCESSION   XM_013247604
VERSION     XM_013247604.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..438
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..438
                     /gene="LOC106084125"
                     /note="uncharacterized LOC106084125; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106084125"
     CDS             58..378
                     /gene="LOC106084125"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084125 isoform X1"
                     /protein_id="XP_013103058.1"
                     /db_xref="GeneID:106084125"
                     /translation="MGNTMSSKLFLTLAAFLAFIAIVASQGAFYLGNRRHPTLDGHCY
                     DNDNDLTLKIDETIYPTLPGKCFKLYCRDDYVLQYNYCPRRPLPCTGHPDFSKPFPEC
                     CNCD"
     misc_feature    184..366
                     /gene="LOC106084125"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      438
                     /gene="LOC106084125"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgacaattaa gatttttcgt tgaactaata ttgtgagaaa ataaatttta ttaaaaaatg
       61 ggtaacacta tgtcctctaa attattctta acattggcag cctttttggc tttcatcgct
      121 attgtggcct cgcaaggagc attttatttg ggaaatcgca ggcatccgac tttggatggt
      181 cactgctatg acaatgacaa tgatttgaca ttaaaaatag atgaaactat ctatcctact
      241 ttaccaggaa aatgctttaa gctgtactgt cgtgacgatt atgtgctaca atacaactac
      301 tgtccacgcc gtcctttacc ttgtacaggt catccggact tttcgaaacc tttccccgaa
      361 tgctgtaatt gtgattgaat gatgtaagag taaaaatata taaattaata aagaaggcat
      421 aaggtccaaa tcaacttt