Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247604 438 bp mRNA linear INV 02-SEP-2023 (LOC106084125), transcript variant X1, mRNA. ACCESSION XM_013247604 VERSION XM_013247604.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..438 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..438 /gene="LOC106084125" /note="uncharacterized LOC106084125; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106084125" CDS 58..378 /gene="LOC106084125" /codon_start=1 /product="uncharacterized protein LOC106084125 isoform X1" /protein_id="XP_013103058.1" /db_xref="GeneID:106084125" /translation="MGNTMSSKLFLTLAAFLAFIAIVASQGAFYLGNRRHPTLDGHCY DNDNDLTLKIDETIYPTLPGKCFKLYCRDDYVLQYNYCPRRPLPCTGHPDFSKPFPEC CNCD" misc_feature 184..366 /gene="LOC106084125" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 438 /gene="LOC106084125" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgacaattaa gatttttcgt tgaactaata ttgtgagaaa ataaatttta ttaaaaaatg 61 ggtaacacta tgtcctctaa attattctta acattggcag cctttttggc tttcatcgct 121 attgtggcct cgcaaggagc attttatttg ggaaatcgca ggcatccgac tttggatggt 181 cactgctatg acaatgacaa tgatttgaca ttaaaaatag atgaaactat ctatcctact 241 ttaccaggaa aatgctttaa gctgtactgt cgtgacgatt atgtgctaca atacaactac 301 tgtccacgcc gtcctttacc ttgtacaggt catccggact tttcgaaacc tttccccgaa 361 tgctgtaatt gtgattgaat gatgtaagag taaaaatata taaattaata aagaaggcat 421 aaggtccaaa tcaacttt