Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084124


LOCUS       XM_013247603             455 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084124), mRNA.
ACCESSION   XM_013247603
VERSION     XM_013247603.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247603.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..455
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..455
                     /gene="LOC106084124"
                     /note="uncharacterized LOC106084124; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106084124"
     CDS             44..355
                     /gene="LOC106084124"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084124"
                     /protein_id="XP_013103057.1"
                     /db_xref="GeneID:106084124"
                     /translation="MSHKQYIAILVLLAMVALATSQGFRSFGNKKHPTLDHHCYDEEH
                     KLTIKVNDTIFPTGFEYQCFKMFCRDDYVLDVSYCPRGTPTCGKKPDFSKPFPECCSA
                     C"
     misc_feature    158..343
                     /gene="LOC106084124"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      455
                     /gene="LOC106084124"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttattgaa agatttgact ggaagacgct tcagttttag aaaatgtctc acaaacaata
       61 catcgccatt cttgttcttt tggctatggt ggcattagcc acatctcaag gttttagaag
      121 ttttggcaat aagaaacatc caaccttgga ccatcattgt tacgatgaag aacataaact
      181 gactattaaa gtgaatgaca ccattttccc caccggtttt gaatatcaat gtttcaaaat
      241 gttctgtcgc gatgattatg ttctagacgt tagttactgt cctaggggta ctccgacttg
      301 tggcaagaaa cccgacttct ctaaaccatt tccagaatgt tgtagcgcct gttaaatttt
      361 agtatattta agtgttaata cttaaagatg gaataataaa acttttaatc tagtaactct
      421 atatgtacta aataaactac taaattttcc atgaa