Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247603 455 bp mRNA linear INV 02-SEP-2023 (LOC106084124), mRNA. ACCESSION XM_013247603 VERSION XM_013247603.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247603.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..455 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..455 /gene="LOC106084124" /note="uncharacterized LOC106084124; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106084124" CDS 44..355 /gene="LOC106084124" /codon_start=1 /product="uncharacterized protein LOC106084124" /protein_id="XP_013103057.1" /db_xref="GeneID:106084124" /translation="MSHKQYIAILVLLAMVALATSQGFRSFGNKKHPTLDHHCYDEEH KLTIKVNDTIFPTGFEYQCFKMFCRDDYVLDVSYCPRGTPTCGKKPDFSKPFPECCSA C" misc_feature 158..343 /gene="LOC106084124" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 455 /gene="LOC106084124" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttttattgaa agatttgact ggaagacgct tcagttttag aaaatgtctc acaaacaata 61 catcgccatt cttgttcttt tggctatggt ggcattagcc acatctcaag gttttagaag 121 ttttggcaat aagaaacatc caaccttgga ccatcattgt tacgatgaag aacataaact 181 gactattaaa gtgaatgaca ccattttccc caccggtttt gaatatcaat gtttcaaaat 241 gttctgtcgc gatgattatg ttctagacgt tagttactgt cctaggggta ctccgacttg 301 tggcaagaaa cccgacttct ctaaaccatt tccagaatgt tgtagcgcct gttaaatttt 361 agtatattta agtgttaata cttaaagatg gaataataaa acttttaatc tagtaactct 421 atatgtacta aataaactac taaattttcc atgaa