Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247593 401 bp mRNA linear INV 02-SEP-2023 (LOC106084116), mRNA. ACCESSION XM_013247593 VERSION XM_013247593.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247593.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..401 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..401 /gene="LOC106084116" /note="uncharacterized LOC106084116; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106084116" CDS 10..321 /gene="LOC106084116" /codon_start=1 /product="uncharacterized protein LOC106084116" /protein_id="XP_013103047.1" /db_xref="GeneID:106084116" /translation="MFQQQIYILCVLLALVAAVASQGSIQYFNRKHPTLENHCYHDMH KLSVKVHETVYPTNVDYQCLKATCSEDYTMDIAYCPRGQPTCGKKPDYSKPFPECCSD C" misc_feature 142..309 /gene="LOC106084116" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 401 /gene="LOC106084116" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcagtgaaaa tgttccagca gcaaatatat attctctgtg ttcttttggc tttggtggca 61 gcagtggcat cacaaggatc catacaatat ttcaatagaa aacatcctac cttggaaaat 121 cattgctatc atgatatgca taaactatct gttaaggtcc atgagactgt atatcccacc 181 aatgtggatt atcaatgcct aaaagcaacc tgtagcgagg attacaccat ggatattgcc 241 tactgtcctc gaggtcaacc cacctgtggc aagaagcctg actattcgaa accctttccg 301 gagtgttgta gcgattgcta atgagcatgg gtattataat gtttctttaa aaaaatccga 361 gggaaagaaa aagtaaataa aaagattcaa aaataagaaa a