Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084116


LOCUS       XM_013247593             401 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084116), mRNA.
ACCESSION   XM_013247593
VERSION     XM_013247593.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247593.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..401
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..401
                     /gene="LOC106084116"
                     /note="uncharacterized LOC106084116; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106084116"
     CDS             10..321
                     /gene="LOC106084116"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084116"
                     /protein_id="XP_013103047.1"
                     /db_xref="GeneID:106084116"
                     /translation="MFQQQIYILCVLLALVAAVASQGSIQYFNRKHPTLENHCYHDMH
                     KLSVKVHETVYPTNVDYQCLKATCSEDYTMDIAYCPRGQPTCGKKPDYSKPFPECCSD
                     C"
     misc_feature    142..309
                     /gene="LOC106084116"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      401
                     /gene="LOC106084116"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcagtgaaaa tgttccagca gcaaatatat attctctgtg ttcttttggc tttggtggca
       61 gcagtggcat cacaaggatc catacaatat ttcaatagaa aacatcctac cttggaaaat
      121 cattgctatc atgatatgca taaactatct gttaaggtcc atgagactgt atatcccacc
      181 aatgtggatt atcaatgcct aaaagcaacc tgtagcgagg attacaccat ggatattgcc
      241 tactgtcctc gaggtcaacc cacctgtggc aagaagcctg actattcgaa accctttccg
      301 gagtgttgta gcgattgcta atgagcatgg gtattataat gtttctttaa aaaaatccga
      361 gggaaagaaa aagtaaataa aaagattcaa aaataagaaa a