Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247588 451 bp mRNA linear INV 02-SEP-2023 (LOC106084113), mRNA. ACCESSION XM_013247588 VERSION XM_013247588.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247588.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..451 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..451 /gene="LOC106084113" /note="uncharacterized LOC106084113; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106084113" CDS 74..388 /gene="LOC106084113" /codon_start=1 /product="uncharacterized protein LOC106084113" /protein_id="XP_013103042.1" /db_xref="GeneID:106084113" /translation="MNFLWVLSLVLAIICVQQTSVTLAVTEPVCAYRNSQDDTVFLKY LPLARRGEEYVDFGTDGKCVKKATCTDTFRTKVDECKQFPVTCSNKRRYDGVFPACCV KC" polyA_site 451 /gene="LOC106084113" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attaaaaaca tctttagttc taattcaact ataacagaat caaagtgtca aatttaaaga 61 atttagcaaa aaaatgaact ttctgtgggt cttatcacta gtattggcga ttatatgcgt 121 tcaacaaaca tcagtaacct tggctgtcac cgaacctgtc tgtgcctata ggaactctca 181 ggatgatacc gtctttctga aatatttacc cttggccaga cgtggagagg aatatgtgga 241 tttcggtacc gatggcaagt gcgttaagaa ggccacttgc acagatacct tcaggaccaa 301 agtggatgaa tgcaaacaat tcccggttac ctgcagcaat aagagacgct acgatggtgt 361 gttcccagct tgttgcgtga aatgctagaa ttaagtgtat agaggagatg ttcgaaacaa 421 gtcattaata aattgagaat tttgttaata a