Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084113


LOCUS       XM_013247588             451 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084113), mRNA.
ACCESSION   XM_013247588
VERSION     XM_013247588.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247588.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..451
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..451
                     /gene="LOC106084113"
                     /note="uncharacterized LOC106084113; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106084113"
     CDS             74..388
                     /gene="LOC106084113"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084113"
                     /protein_id="XP_013103042.1"
                     /db_xref="GeneID:106084113"
                     /translation="MNFLWVLSLVLAIICVQQTSVTLAVTEPVCAYRNSQDDTVFLKY
                     LPLARRGEEYVDFGTDGKCVKKATCTDTFRTKVDECKQFPVTCSNKRRYDGVFPACCV
                     KC"
     polyA_site      451
                     /gene="LOC106084113"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaaaaaca tctttagttc taattcaact ataacagaat caaagtgtca aatttaaaga
       61 atttagcaaa aaaatgaact ttctgtgggt cttatcacta gtattggcga ttatatgcgt
      121 tcaacaaaca tcagtaacct tggctgtcac cgaacctgtc tgtgcctata ggaactctca
      181 ggatgatacc gtctttctga aatatttacc cttggccaga cgtggagagg aatatgtgga
      241 tttcggtacc gatggcaagt gcgttaagaa ggccacttgc acagatacct tcaggaccaa
      301 agtggatgaa tgcaaacaat tcccggttac ctgcagcaat aagagacgct acgatggtgt
      361 gttcccagct tgttgcgtga aatgctagaa ttaagtgtat agaggagatg ttcgaaacaa
      421 gtcattaata aattgagaat tttgttaata a