PREDICTED: Stomoxys calcitrans ras-related protein Rab-18

LOCUS       XM_013247253             967 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083931), mRNA.
ACCESSION   XM_013247253
VERSION     XM_013247253.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247253.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..967
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..967
                     /gene="LOC106083931"
                     /note="ras-related protein Rab-18; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1 EST,
                     12 Proteins"
                     /db_xref="GeneID:106083931"
     CDS             120..713
                     /gene="LOC106083931"
                     /codon_start=1
                     /product="ras-related protein Rab-18"
                     /protein_id="XP_013102707.1"
                     /db_xref="GeneID:106083931"
                     /translation="MLSDKAIKLLVIGESGVGKSSLIRRFVENKFDESHDVTIGMDFK
                     SKVMNIDGVDYKLALWDTAGAERFRSLTPSFYRKALGAILVYDIKNRESLVKLEAWFT
                     ELENYSDNPNISTIVVGNKIDDERVVSREEGLKFARKHRSLFLETSAKNDKFVADVFR
                     DIVEKIVSSEHFEQLNNGDRIEVRSDDDDAAASYCRC"
     misc_feature    138..617
                     /gene="LOC106083931"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    156..179
                     /gene="LOC106083931"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(162..182,309..311,477..482,486..488,561..569)
                     /gene="LOC106083931"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    231..233
                     /gene="LOC106083931"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    243..251
                     /gene="LOC106083931"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    300..311
                     /gene="LOC106083931"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(306..311,357..362)
                     /gene="LOC106083931"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    477..488
                     /gene="LOC106083931"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    561..569
                     /gene="LOC106083931"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     polyA_site      967
                     /gene="LOC106083931"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgactaatcg aaatcgaatt ttagttccct atgtccaata aaaataaatg aaatatatat
       61 aaatacgcaa tttttatgtt tatattttca tataaacttg ttctaatcat tatttgataa
      121 tgctgagtga taaagctata aaacttctag taattggaga aagtggagtg gggaaatcaa
      181 gtcttatacg ccgctttgtg gaaaacaaat tcgatgaaag ccatgatgtc accattggta
      241 tggacttcaa gagcaaagtc atgaatatcg atggcgttga ttataaactg gcgctttggg
      301 atacagccgg tgcggaaaga tttcgcagtt taactcccag cttctaccgc aaagcactgg
      361 gagcaatttt ggtgtatgac attaaaaacc gcgaatcact ggtaaaactg gaggcatggt
      421 tcacagaact ggaaaactat agtgataatc caaatatatc aacaattgtg gtgggcaaca
      481 aaatagatga cgagcgcgtt gttagtcgag aggaaggttt aaaatttgct cgtaaacatc
      541 gttctttgtt tttggaaact tcggcaaaaa atgataaatt tgtggctgat gtgtttagag
      601 atattgtgga aaagattgta tcatcggaac attttgaaca gctaaataat ggagatagaa
      661 ttgaggttcg ttcagatgat gacgatgctg ccgcctcgta ttgtagatgt tgatcattat
      721 ctagaaatgg ttgtatgttt gcatttgttt ctgtcactct tctgtatgta tgtgatgcaa
      781 tattgaagaa atacttatta atcattttta ccatgtttat gttatagtta tataaacttt
      841 tctttttggt aaggtattga tagaaaaatc tagtatttat tatgtaatct gtgtaccaac
      901 agtaaatctc tatatcataa gataataaat aaacttaaca tgtgtaggtt tctaccgagt
      961 tgctaga